KEGG   Miniopterus natalensis: 107533453
Entry
107533453         CDS       T05883                                 

Gene name
ACOT4
Definition
(RefSeq) acyl-coenzyme A thioesterase 4
  KO
K01068  acyl-coenzyme A thioesterase 1/2/4 [EC:3.1.2.2]
Organism
mna  Miniopterus natalensis
Pathway
mna00062  Fatty acid elongation
mna01040  Biosynthesis of unsaturated fatty acids
mna01100  Metabolic pathways
mna04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    107533453 (ACOT4)
   01040 Biosynthesis of unsaturated fatty acids
    107533453 (ACOT4)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    107533453 (ACOT4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mna01004]
    107533453 (ACOT4)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.2  palmitoyl-CoA hydrolase
     107533453 (ACOT4)
Lipid biosynthesis proteins [BR:mna01004]
 Fatty acid synthase
  Component type
   107533453 (ACOT4)
SSDB
Motif
Pfam: BAAT_C DLH FSH1 Peptidase_S9
Other DBs
NCBI-GeneID: 107533453
NCBI-ProteinID: XP_016063623
LinkDB
Position
Unknown
AA seq 281 aa
AGRVRATLFLPPGPGPFPGIIDLFGIGGGLLEYRASLLAGHGFATLALAYYDFEDLPKEF
DSRNMDYFEEAVCYMLQHPQVKGPGIGLLGISLGADICLSMASFLKNISATVSINGSGFS
GNKAICYKETYIPPLGHDLRRIKVSFSGLLDIVDIRNDIVGGCEHPSMIPIEKAQGPILF
ITGQDDHNWRSELYAQIASERLQAHGKEKPQIISYPGTGHYIEPPYFPMCPASLHKLMKK
PVIWGGEPRAHSKAQVDAWKQILTFFYTHLGGTPKGASPKL
NT seq 846 nt   +upstreamnt  +downstreamnt
gcgggccgggtgcgcgccacgctcttcctgccgccaggacctggacctttcccagggatc
attgatctctttggtattggagggggcctgttggaatatcgagccagccttctggctggc
catggctttgccacattggctttagcttattacgactttgaagatctccccaaggaattt
gacagtagaaatatggactactttgaagaagccgtgtgctacatgcttcaacacccccag
gtaaaaggcccaggcattggccttctgggcatttctttaggggctgatatttgtctttcc
atggcctcctttttgaagaacatctcagctacagtttccatcaatgggtctgggttcagt
ggaaacaaagccatatgctacaaggagacttacatcccaccattgggccatgacctgagg
agaatcaaggtctctttctcaggcctcctggacattgtggatatacggaatgatattgta
ggagggtgtgaacaccccagcatgattccaatagagaaggcccagggacctatcctcttc
atcactggtcaggatgaccataactggaggagtgagttatatgcccaaatagcctctgaa
cgcttacaggcccatggaaaggaaaaacctcagatcatctcttatcctgggactgggcat
tatattgagcctccttacttccccatgtgcccagcttccttgcacaaactaatgaaaaag
cctgtaatctggggtggggagcccagggctcattctaaggcccaggtagatgcttggaag
caaattttgacctttttctacacacatcttggaggtaccccgaagggagcttcccctaaa
ttatag

KEGG   Miniopterus natalensis: 107533473
Entry
107533473         CDS       T05883                                 

Definition
(RefSeq) acyl-coenzyme A thioesterase 1-like
  KO
K01068  acyl-coenzyme A thioesterase 1/2/4 [EC:3.1.2.2]
Organism
mna  Miniopterus natalensis
Pathway
mna00062  Fatty acid elongation
mna01040  Biosynthesis of unsaturated fatty acids
mna01100  Metabolic pathways
mna04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    107533473
   01040 Biosynthesis of unsaturated fatty acids
    107533473
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    107533473
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mna01004]
    107533473
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.2  palmitoyl-CoA hydrolase
     107533473
Lipid biosynthesis proteins [BR:mna01004]
 Fatty acid synthase
  Component type
   107533473
SSDB
Motif
Pfam: BAAT_C Bile_Hydr_Trans DLH FSH1 Peptidase_S9
Other DBs
NCBI-GeneID: 107533473
NCBI-ProteinID: XP_016063651
LinkDB
Position
Unknown
AA seq 464 aa
MMASSPAVLRAPGLCRWGLRGWAWLPRPTNLRPGDPVSGATVRMAATVTVEPGGRCSWDE
PVRITVSDLAAGQRVTLRSSLRDEKGALFRAHARYSADARGELDLARAPALGGSFTGIEP
MGLLWALEPEKPGLRLIKRDVQTPFSVELEVLDGHEPEGGRLLGRAVHERHFLAPGVRRE
PVHAGRVRATLFLPPEPGPFPGIVDIYGAGGGLPEYRASLLAGKGFAVMALAYYNYEDLP
KGMENIHLEYFEEAVNYLLNHPQVKGPGVGLLGISKGGELCLSMASFLKGITAAVIINGS
VANVGGALHYKGETLPPVGLNVSRIRITKDGFAYIWDALNSPLEGPDQKSFIPVERAESS
FLFLVGQDDQNWKSEFYANEASKRLQAHGKEKPQIICYPGTGHYIEPPYFPMCRASLHTL
VGRPVIWGGEPRAHAMAQEDAWKQLQTFFHKHLGREKEIIPPTL
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgatggcctcatctcccgctgtcctgcgagcacctggactctgccgatggggcctgaga
ggttgggcatggctgcccaggcctacaaacttgaggcctggtgacccggtctctggggcc
actgtccggatggcggcgacagtgacggtggagcccgggggccgctgcagctgggacgag
cccgtgcgcatcaccgtcagcgacctggctgcggggcagcgggtcacgctgcgatcgtcc
ctgcgcgacgagaagggcgcgctcttccgggcccacgcccgttacagcgcggacgcccgc
ggcgagctggacctggcgcgcgcgcccgcgctgggcggcagcttcaccgggatcgagccc
atggggctcctctgggccctggagcccgagaagcccggcctgcgtctgataaagcgggac
gtgcagacgcctttctccgtggagctggaggtgctcgacggccacgagcccgagggcggg
cggctcctcggtcgggcggtgcacgagcgccacttcctcgcgcccggggtgcggcgggag
ccggtgcacgcgggccgggtgcgcgccacgctcttcctgccgccagaacctgggcccttt
cctgggattgtggacatttacggagctggaggtggccttccggaatatcgagctagtctg
ctggctgggaagggttttgctgtgatggctctggcttattataactatgaagacctcccc
aagggcatggagaacatccatctggagtactttgaagaagctgtgaactacctgcttaat
caccctcaggtaaagggtccaggagttgggctgcttgggatttccaaaggaggtgagctc
tgcctctccatggcctcgtttctgaagggcatcaccgctgcagtcataatcaatggctcc
gtggccaatgttggaggggccttacactataagggtgagaccctgcctcctgtaggttta
aacgtaagtcgaatcaggataaccaaagatggctttgcatacatttgggatgccctgaac
agccctttggaaggacctgaccagaagagcttcattcctgtggaaagggctgagagcagc
ttcctgttccttgtaggtcaggatgaccagaactggaagagtgaattctatgctaatgaa
gcctctaaacgcttacaggcccatggcaaggagaagcctcagatcatctgttacccaggg
acggggcactacatcgagcctccttactttcccatgtgccgggcttccctgcacacctta
gtgggtagacctgtcatttggggaggagagcccagggctcatgccatggcccaggaagat
gcttggaagcagctccagacttttttccacaaacacttgggtagggaaaaggagataatc
ccaccaacactttaa

KEGG   Miniopterus natalensis: 107533476
Entry
107533476         CDS       T05883                                 

Definition
(RefSeq) acyl-coenzyme A thioesterase 1-like
  KO
K01068  acyl-coenzyme A thioesterase 1/2/4 [EC:3.1.2.2]
Organism
mna  Miniopterus natalensis
Pathway
mna00062  Fatty acid elongation
mna01040  Biosynthesis of unsaturated fatty acids
mna01100  Metabolic pathways
mna04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    107533476
   01040 Biosynthesis of unsaturated fatty acids
    107533476
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    107533476
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mna01004]
    107533476
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.2  palmitoyl-CoA hydrolase
     107533476
Lipid biosynthesis proteins [BR:mna01004]
 Fatty acid synthase
  Component type
   107533476
SSDB
Motif
Pfam: BAAT_C DLH FSH1 Peptidase_S9 AXE1
Other DBs
NCBI-GeneID: 107533476
NCBI-ProteinID: XP_016063652
LinkDB
Position
Unknown
AA seq 248 aa
MFGDGGLNESRASLLACRGFATLALPFFGYEDLPPIMKDLNLDYFEEAAKFVQSHPKVKG
PNIGVIGSGKGAELALSMASFLPNIAAVVSINGCISNTATALTCGGLILPGLPFNLDRIS
ATSSGVYDVKEALEDPLDPAYQKSRIPLEKASAHFLFIVGEDDRHWKSSVYADIAGKHLT
EHGKTNFTLLSYPNAGHRIDPPYSPFFSAALDPVLGVPVLGGGQLKAHAIAQIESWKKIL
EFLHLHLG
NT seq 747 nt   +upstreamnt  +downstreamnt
atgttcggtgatggagggttaaatgaatctcgagcgagtctcctggcttgtcgaggtttt
gctactctggctttgccgttttttggctatgaagatctacctccaatcatgaaggactta
aatttagattactttgaggaggcagctaaatttgtgcaaagtcatccaaaggtcaaaggt
ccaaacattggagtgattggctctggcaaaggggcagagttggcgctttccatggctagc
tttctcccaaatatagctgcggttgtgagcatcaatggctgcatctctaacacagccact
gcccttacatgtggtggattaatcctgccaggactgccttttaacctggacagaatctct
gctaccagttcaggggtatatgatgttaaagaagccctggaggaccccttggatccagcc
tatcagaaaagccgtatccccctggaaaaagccagtgcccatttcctttttatcgttgga
gaggatgacaggcattggaagagctctgtgtatgctgacatagctgggaagcacctcaca
gagcatgggaagacaaatttcactcttttaagctaccctaatgccggccacagaatagat
cccccttacagcccttttttctctgcagccctggaccctgtattgggggtgcctgttttg
ggaggtgggcagctcaaagctcacgctattgctcagattgagtcttggaagaagatcttg
gagtttttgcacttgcatctagggtaa

DBGET integrated database retrieval system