KEGG   Miniopterus natalensis: 107533494
Entry
107533494         CDS       T05883                                 

Gene name
TIAM1
Definition
(RefSeq) T-lymphoma invasion and metastasis-inducing protein 1
  KO
K05731  T-lymphoma invasion and metastasis-inducing protein 1
Organism
mna  Miniopterus natalensis
Pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04024  cAMP signaling pathway
mna04062  Chemokine signaling pathway
mna04530  Tight junction
mna04810  Regulation of actin cytoskeleton
mna05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107533494 (TIAM1)
   04015 Rap1 signaling pathway
    107533494 (TIAM1)
   04024 cAMP signaling pathway
    107533494 (TIAM1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107533494 (TIAM1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107533494 (TIAM1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107533494 (TIAM1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107533494 (TIAM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mna04990]
    107533494 (TIAM1)
Domain-containing proteins not elsewhere classified [BR:mna04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   107533494 (TIAM1)
SSDB
Motif
Pfam: RhoGEF Tiam_CC_Ex PH RBD PDZ PH_9 PDZ_2 PDZ_6
Other DBs
NCBI-GeneID: 107533494
NCBI-ProteinID: XP_016063696
LinkDB
Position
Unknown
AA seq 1519 aa
MGNAESQNVEHAFYGEKHAGLGRKHTSRSLRLSHKARRIRHASSGKALPRGSEVSTRSSS
TPSIPQSLAENGLEPFSQEGALEDFGNPIWVDRVDMGLRPVSYTDSSVAPSVDSSIVLTA
ASVQSMPDSEEGRLYADDGPYLPEGSRRQHPCACPGPTFPESASFKKKRSKSADIWREDS
LEFSLSDLSQEHLTSNEEILGSAEEKDCEEARGTDTRAGPRPLGACQRANSLSDLYAQKS
PGAMANGGPRSRCAGYCRNLVSDMPHLANRKMPSAAAEDALPYSTYSTLPCRKSHCLSEG
PSNPQLSHSNSMQGRRAKTTQGGCGLEAPRMPGEEMGDVSGCAEDVGHCCTGSAPALSSL
DFTHPCFQPFPGDRHQPWSPLQTFCCTATRHSRSPVLFPGCTLLFYENDGRSGMEPSSVP
KHAVWVENSIVQAVPEHPKKDFVFCLSNSLGDAFLFQTTSQTELENWITAIHSACSAAVA
RHHHKEDTLRLLKSEIKKLEQKIDMDEKMKKMGEMQLSSVSDAKKKKTILDQIFVWEQNL
EQFQMDLFRYRCYLASLQGGELPNPKRLLAFASRPTKVAMGRLGIFSVSSFHALVAARTG
ETGVRRRTQAMSRSTSKRRSRFSSLWGLDTTSKKKQGHPSINQVFGEGPDAVKQSLEGVF
EDTVPDGKMEKEMGLPSVHQQNPDCDIWVHEYFTPSWFCLPNNQSALTVVRPGDTARDTL
ELICKTHHLDPSAHYLRLKFLIENTLQVYVPEPEEDIYELLYQEIEICPKVTRRLQVEKS
DAAGENYGFSLSSVEEEGVRRLYVNSVKETGLASKKGLKAGDEILEISNRAAATLSSSAL
RDFLSQPSLGLLVRTRPELEGGTPLLGSPPRRAESPAEPGQGPLAFLASSPGHSLCGAQG
SSAETAPEEAEGPDVESSDDTDHSSKSTEQGAASCHSPREMNPSDPSPSPQDPGGPQLST
TRQLTDADKLRKVICELLETERTYVKDLNCLMERYLKPLQKETFLTHDELDVLFGNLTEM
VEFQVEFLKTLEDGVRLVPDLENLERVDQFKKVLFSLGGSFLYYADRFKLYSAFCASHTK
VPKVLVKARTDAAFKAFLDAQNPRQQHSSTLESYLIKPIQRVLKYPLLLRELYALTDADS
EEHYHLDVAIKTMNKVASHINEMQKIHEEFGAVFDQLIAEQTGEKKEVADLSMGDLLLHT
TVIWPNPPASLGKWKKEPELAAFVFKTAVVLVYKEGSKQKKKLVGSHRLSIYEEWDPFRF
RHMIPTEALQVRTLATADAEANAVCEIVHVKSESEGRPERVFHLCCSSPKSRKDFLKAVH
SILRDKHRRQLLKTESLPSSQQYVPFGGKRLCALKGARPAMSRAVSAPSKSLGRRRRRLA
RNRFTIDSDAVSASSPERESQQPPGAGDTDRWVEEQFDLAQYEEQDIKETDILSDEDEVC
EAARGSDGDGDLPERLRAASLGPRERGRRSLDSHASRMTQLRKQAALSGGSGGPEHAGEE
VVWVRREDFAPSRKLNTEI
NT seq 4560 nt   +upstreamnt  +downstreamnt
atggggaatgcggagagtcagaacgtggagcacgcgttctacggagaaaagcatgccggc
ctggggcgcaagcacacctcgcgctccctgcgcctgtcgcacaaggcgcggcgcatccgg
cacgcgtcctccgggaaggccctccccaggggctctgaggtgagcacgcggtccagcagc
acccccagcatcccgcagtcgctggccgagaacggcctggagcccttctcccaggagggc
gccctggaggacttcgggaaccccatctgggtggaccgcgtggatatgggcttgcgaccc
gtgtcctacaccgactcctccgtggcccccagcgtggacagcagcattgtgctcacagcg
gcctcggtgcagagcatgcccgactcggaggagggcaggctctacgctgacgacgggccc
tacctgcccgagggaagccggaggcagcacccctgcgcctgcccggggcccacgttcccg
gagtccgccagctttaagaagaaacggtccaagtctgcagacatctggcgggaggacagc
ctggaattctcgctgtctgatctgagccaagaacatttaaccagcaatgaggagatcctg
ggttccgccgaggagaaagactgcgaggaggcgcggggcacggacacccgggcggggccg
cggccgctcggagcctgtcagcgtgccaactccttgagtgacctgtatgcccagaaaagc
cccggggcgatggccaacggggggcccaggagcagatgcgcaggctattgtcggaacctg
gtgtcggacatgccccaccttgccaaccgaaagatgccatcggccgctgccgaggacgcc
cttccctacagcacctatagcacccttccctgcaggaagtctcactgcctgtccgagggc
ccctccaacccacagctcagccacagcaacagcatgcagggccggagagccaagaccact
cagggcggctgtggcctggaggcaccgcgcatgcctggcgaggagatgggggatgtgagc
ggctgtgccgaggacgtgggacactgttgtacgggctcggcccctgctctttcctccctg
gatttcacacacccttgtttccagccctttcccggtgaccgtcaccagccatggtctccc
ctgcagaccttttgctgcacggccacccgacactcacgcagccccgttctgttcccaggg
tgcacgctgctcttctacgagaacgatggcaggtcggggatggagcccagcagtgtcccc
aagcacgccgtgtgggtggagaacagcattgtgcaggccgtgcccgagcaccccaagaag
gacttcgtcttctgcctcagcaactccctgggcgacgccttcctcttccagaccaccagc
cagacggagctagagaactggatcaccgccatccactcggcctgctcggccgcggtcgcc
aggcaccaccacaaggaggacacgctccgcctcctcaagtccgagatcaagaagctggag
cagaagatcgacatggatgaaaagatgaagaaaatgggcgagatgcagctgtcgtccgtc
agcgacgccaagaagaagaagaccatcctagaccagatcttcgtttgggagcagaatctc
gaacagttccagatggacctctttcgttaccgctgctacctcgccagtctccagggtggg
gagctgcccaaccccaagaggctcctggcttttgcgagccgaccgacgaaggtggccatg
gggcgcctgggaatcttctccgtctcgtcctttcacgccctggtggccgcccgcaccggc
gagacgggagtgagacggcgcacccaggccatgtcccggtccacgagcaagcggaggagc
aggttctcgtctctctggggtctggacacaacctccaagaagaagcagggacaccccagc
atcaatcaggtgtttggtgagggacccgacgccgtcaagcagtctttggagggcgtattt
gaagacaccgtcccggatggcaagatggagaaggagatgggcctgcccagcgtccaccag
cagaatcctgactgtgacatttgggtccacgagtatttcactccgtcctggttctgtctg
ccgaacaaccagtctgcgctgacggtcgtgcggccgggcgacaccgcgcgggacactctg
gagctgatctgcaagacgcaccatctggacccgtccgctcattacctgcgtctgaagttt
ctgatcgagaacacgctgcaggtctacgtgccggagcccgaggaggacatctacgaactg
ctctaccaagaaattgaaatttgtccgaaagtcactcggaggctccaggttgagaagtcg
gatgcggccggggaaaattacgggttctcgctgtcgtccgtggaggaagagggcgtccgg
aggctctacgtgaacagcgtgaaggaaaccggcttagcttccaagaaagggctgaaggcg
ggagatgagattctcgagatcagtaatcgcgcggccgccaccctgagctcctcggcgctc
agagacttcctctcgcagcccagcctgggcctcctggtgaggacgcgccccgagctggag
gggggcaccccgctgctgggcagcccaccccgccgcgccgagagccccgccgagcctggc
cagggccccctcgccttcctcgccagcagcccagggcacagcctgtgtggcgcccagggc
agcagcgctgagaccgcccccgaggaggccgaggggccagacgtggagtcctcagatgac
accgaccacagcagcaagagcacggaacagggggccgcgtcctgccacagtccgcgcgag
atgaaccccagtgacccgagcccgtccccccaggaccccggcgggccgcagctgtccacc
acgcggcagctcacggacgccgacaagctgcgcaaggtgatctgcgagctcctggagacg
gagcgtacctacgtgaaggacttgaactgcctcatggagagatacctaaaaccgcttcag
aaggagacttttctcacccacgatgagctggatgtgctctttggaaacttaaccgaaatg
gtcgagtttcaagtagaattccttaaaaccctggaagatggggtgagactagtgccggat
ctggaaaaccttgagagagttgatcagtttaagaaggtgctgttctccctggggggctcc
ttcctgtactatgccgaccgcttcaagctctacagtgccttctgcgccagccacacgaag
gtgcccaaggtcctggtgaaagccaggacggacgcggcgttcaaagccttcctggacgcg
cagaacccgaggcagcagcactcgtccacactggagtcgtacctcatcaagcccatccag
agggtcctcaagtacccgctgctgctgcgggagctctacgcgctgacggacgccgacagc
gaggagcactaccacctggacgtggccatcaagaccatgaacaaggtcgccagtcacatc
aacgagatgcagaagatccacgaggagtttggggccgtgtttgaccagctgattgctgaa
cagacgggtgaaaaaaaagaggtggcggacctgagcatgggcgacctgctgctgcacacc
accgtgatctggccgaacccgcccgcctcgctggggaagtggaagaaggagccggagttg
gccgccttcgtcttcaaaacggccgtggtccttgtgtataaagagggctccaaacagaag
aagaaacttgtgggatctcacaggctgtccatctacgaggagtgggaccccttccggttt
cggcacatgatccccacggaagcgctgcaggttcgcaccttggccactgcagatgcagaa
gccaacgcggtgtgcgagatcgtccacgtcaagtccgagtcggaagggaggccggagagg
gtgttccacctgtgctgcagctcccccaagagccggaaggatttcctgaaggccgtgcac
tcgattctccgcgacaagcacagaaggcagctcctcaagaccgagagcctgccctcgtcc
cagcaatatgtccctttcggagggaagcgactgtgtgcgctgaagggggcccggccggcc
atgagcagggcagtgtccgccccaagcaagtctcttggcagaaggaggcggcgactggcc
cgaaacaggttcaccatcgattccgacgctgtgtccgccagcagccccgagagagagtcc
cagcagccccctggtgccggggacactgaccggtgggtggaggaacagttcgacctggct
caatacgaggagcaggacatcaaggagacggacattctcagcgatgaggacgaggtctgt
gaggccgcgaggggctccgatggggacggagacctgcccgagcggctccgggcggcctcc
ctcggcccgcgggagaggggccgcaggagcctggacagtcacgcgtcccgcatgacgcag
ctcaggaagcaggcggcgctgtcggggggcagcggaggccccgagcacgcgggcgaggaa
gtcgtctgggtcaggcgggaagacttcgccccgtccaggaaactgaacacggagatctga

DBGET integrated database retrieval system