KEGG   Miniopterus natalensis: 107533496
Entry
107533496         CDS       T05883                                 

Gene name
MRAP
Definition
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
mna  Miniopterus natalensis
Pathway
mna04927  Cortisol synthesis and secretion
mna04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    107533496 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107533496 (MRAP)
SSDB
Motif
Pfam: MRAP FixQ DUF420 Salyut
Other DBs
NCBI-GeneID: 107533496
NCBI-ProteinID: XP_016063698
LinkDB
Position
Unknown
AA seq 150 aa
MANGTNASTPHYSYEYYLDYLDLIPVDEKKLRAHKYSVVIAFWVSLAAFVVLLFLILLYM
SWPSSPQARNAQHRSTCPWSLHLDLPLCVRRHLLLHRASQGTPQASLSSAGEGEPGSRAS
DASASTPTAPEAHPALLWDQALDGDPHSIS
NT seq 453 nt   +upstreamnt  +downstreamnt
atggccaacgggaccaacgcctccaccccgcactacagctacgagtactacctggactac
ctggacctcatccctgtggacgaaaagaagctgagagcccacaaatactccgtggtcatc
gccttctgggtgagcctggcggccttcgtggttctcctgtttctcatcctgctctacatg
tcctggccgagctccccacaggccaggaatgcccagcaccgctccacgtgcccctggagt
ctccacctcgacctccccctctgcgtccggaggcaccttctgctgcacagggcctcccag
gggaccccacaggcctcactgagctcagctggggagggggagccaggcagcagagcatcc
gacgcctctgcctcaacccctactgccccggaggcccaccctgccctcctgtgggaccag
gccctcgatggggacccccacagcatcagctga

DBGET integrated database retrieval system