KEGG   Miniopterus natalensis: 107533516
Entry
107533516         CDS       T05883                                 

Gene name
GHSR
Definition
(RefSeq) growth hormone secretagogue receptor type 1
  KO
K04284  growth hormone secretagogue receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04024  cAMP signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107533516 (GHSR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107533516 (GHSR)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    107533516 (GHSR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107533516 (GHSR)
G protein-coupled receptors [BR:mna04030]
 Rhodopsin family
  Peptide
   Ghrelin
    107533516 (GHSR)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srw 7TM_GPCR_Srv 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Other DBs
NCBI-GeneID: 107533516
NCBI-ProteinID: XP_016063725
LinkDB
Position
Unknown
AA seq 391 aa
MSPSTSASARHFSLFPRLASSPRARPXSLADELPPLFPAPLLAGVTAACVALFVVGIAGN
LLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQF
VSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVILVIWAVAFCSAGPIFVL
VGVEHENGTDPRDTNECRATEFAVSSGLLTVMVWVSSVFFFLPVFCLTVLYSLIGRKLWR
RGRGEAVAASLRDQNHKQTVKMLAVVVLAFILCWLPFHVGRYLFSKSFEPGSLEIAQISQ
YCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFRLLGFEAFSQRKLSTLKEESSRAWTES
SINTRASTSLSKVIAYYSTLEATAQQDLGGS
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgtccccttccacctcggcttcggctcgtcacttttctctttttcctcgactagcttcc
tccccgcgcgcccggcccncctcgctggccgacgagctgccgccgctgttccccgcgccg
ctgctggccggcgtcacggccgcctgcgtggcgctcttcgtggtgggcatcgcgggcaac
ctgctcaccatgctggtggtgtcccgcttccgcgagcttcgcaccaccaccaacctctac
ctgtccagcatggccttctccgacctgctcatcttcctctgcatgcccctggacctcgtg
cgcctctggcagtaccggccctggaacttcggcgacctgctctgcaaactcttccagttc
gtcagcgagagctgcacctacgccacggtgctcaccatcacggcgctcagcgtcgagcgc
tacttcgccatctgcttcccgctgcgggccaaggtggtggtcaccaaaggccgggtgaag
ctggtcatcctggtcatctgggccgtggccttctgcagcgccgggcccatcttcgtgctg
gtgggcgtggagcacgagaacggcaccgacccccgggacaccaacgagtgccgcgccacc
gagttcgccgtgagctcggggctgctgaccgtcatggtgtgggtgtccagcgtcttcttc
ttcctgcccgtcttctgcctcacggtgctctacagcctcatcggcaggaagctgtggcgc
cgggggcgcggcgaggccgtggccgcctcgctcagggaccagaaccacaagcaaaccgtg
aagatgctggctgtggtggtgttggcgttcatcctctgctggctgcccttccacgtgggg
cggtacctcttctccaagtccttcgagcccggctccctggagattgcccagatcagccag
tactgcaacctggtgtcctttgtgctcttctacctcagcgccgccatcaaccccattctc
tacaacatcatgtccaagaagtaccgcgtggccgtgttcagactcctggggtttgaagct
ttctcccagaggaagctgtccaccctgaaggaggagagctctcgggcctggacagaatcc
agtattaacacaagggcaagcacctcgctgagcaaggtcatcgcttattattccaccctg
gaagccacagcacagcaggacttgggaggaagctga

DBGET integrated database retrieval system