KEGG   Miniopterus natalensis: 107533528
Entry
107533528         CDS       T05883                                 

Gene name
NCEH1
Definition
(RefSeq) neutral cholesterol ester hydrolase 1
  KO
K14349  neutral cholesterol ester hydrolase 1 [EC:3.1.1.-]
Organism
mna  Miniopterus natalensis
Pathway
mna04927  Cortisol synthesis and secretion
mna04934  Cushing syndrome
mna04976  Bile secretion
mna04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    107533528 (NCEH1)
  09154 Digestive system
   04976 Bile secretion
    107533528 (NCEH1)
   04979 Cholesterol metabolism
    107533528 (NCEH1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107533528 (NCEH1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mna01002]
    107533528 (NCEH1)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     107533528 (NCEH1)
Peptidases and inhibitors [BR:mna01002]
 Serine peptidases
  Family S9: prolyl oligopeptidase family
   107533528 (NCEH1)
SSDB
Motif
Pfam: Abhydrolase_3 COesterase Peptidase_S9 Say1_Mug180 AXE1 Chlorophyllase2 Esterase_PHB
Other DBs
NCBI-GeneID: 107533528
NCBI-ProteinID: XP_016063735
LinkDB
Position
Unknown
AA seq 408 aa
MRSSCVVLTALVALAAYYVYIPLPSSVSDPWKLMLLDATFRGAQQASNLMHYLGLSHHLL
ALNFIIVSFGKKSAWSSARVKVTDTDFDGVEVRVFEGSPKPDEPLRRSVVYIHGGGWALA
SAKIRYYDELCTAMAEELNAVIVSIEYRLVPKVYFPEQIHDVVRATKYFMQPEVLQKYSV
DPSRIGISGDSAGGNLAAALGQQFSQDANLRNKLKVQALIYPALQALDFNTPSYQQNVNA
PILPRYVMVKYWVDYFKGNYDFVQAMIVNNHTSLDVAEAAALRARLNWTSLLPASITKNY
RPVVQPTGDARIVREIPQLLDARSAPVIADESVLQHLPKTYILTCEHDVLRDDGILYAKR
LESVGVEVTIDHFEDGFHGCIIFTSWPTNFSVGIRTRNSYIKWLDQNL
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgaggtcgtcgtgcgtggtgctcaccgccctggtggcgctggccgcctattatgtctac
atcccgctgcccagctccgtgtccgacccctggaagctgatgctgctggacgcgactttc
cggggcgcgcagcaagcgagtaacctgatgcactacctgggcctgagccaccatctgctc
gcactgaattttatcatcgtttctttcggcaagaaaagcgcatggtcatctgctcgggtg
aaggtgaccgacaccgactttgacggcgtggaagtcagagtgtttgaaggctctccaaag
ccagacgagcctctgaggcgcagtgttgtttatatccacgggggaggctgggccttggca
agcgcaaaaatcagatattatgatgaactgtgtacagcaatggctgaggagttgaatgct
gtcattgtctccattgaatataggctagtgccaaaggtttattttcctgagcaaattcat
gatgttgtacgtgccacgaagtatttcatgcagccggaggtcttgcagaagtattcggtg
gacccaagcagaatcggcatttctggtgacagtgctggtgggaatttggccgccgccctg
ggccaacagtttagtcaagatgccaacctgagaaacaagctcaaagtgcaagctttaatt
tatccggcccttcaagctttagattttaacacgccctcttatcagcaaaatgtgaacgcc
ccgatcctgccccgatacgtcatggtcaagtactgggtggactacttcaaaggcaactat
gactttgtccaggcaatgatagtgaacaatcacacgtccctcgatgtggcagaggctgcg
gccctcagggcccgtctgaactggacatccctcctgcccgcgtccatcaccaagaactac
aggcccgtggtgcagcccaccggcgacgccaggattgtccgggagatccctcagctgctg
gacgcccgctctgcccccgtcatcgcggacgagagcgtcctgcagcacctccccaagacc
tatattctgacgtgtgagcacgacgtcctgcgagacgacgggatcctgtatgcgaagcgt
ttggagagcgtaggcgtggaggtgaccatcgatcacttcgaggatggcttccatgggtgc
attattttcaccagctggcccaccaacttctctgtgggaatccggactaggaacagttac
atcaagtggctggatcaaaacctgtga

DBGET integrated database retrieval system