KEGG   Miniopterus natalensis: 107533544
Entry
107533544         CDS       T05883                                 

Gene name
RELA
Definition
(RefSeq) transcription factor p65
  KO
K04735  transcription factor p65
Organism
mna  Miniopterus natalensis
Pathway
mna01523  Antifolate resistance
mna04010  MAPK signaling pathway
mna04014  Ras signaling pathway
mna04024  cAMP signaling pathway
mna04062  Chemokine signaling pathway
mna04064  NF-kappa B signaling pathway
mna04066  HIF-1 signaling pathway
mna04071  Sphingolipid signaling pathway
mna04137  Mitophagy - animal
mna04151  PI3K-Akt signaling pathway
mna04210  Apoptosis
mna04211  Longevity regulating pathway
mna04218  Cellular senescence
mna04380  Osteoclast differentiation
mna04613  Neutrophil extracellular trap formation
mna04620  Toll-like receptor signaling pathway
mna04621  NOD-like receptor signaling pathway
mna04622  RIG-I-like receptor signaling pathway
mna04623  Cytosolic DNA-sensing pathway
mna04625  C-type lectin receptor signaling pathway
mna04657  IL-17 signaling pathway
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna04660  T cell receptor signaling pathway
mna04662  B cell receptor signaling pathway
mna04668  TNF signaling pathway
mna04722  Neurotrophin signaling pathway
mna04917  Prolactin signaling pathway
mna04920  Adipocytokine signaling pathway
mna04926  Relaxin signaling pathway
mna04931  Insulin resistance
mna04932  Non-alcoholic fatty liver disease
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05030  Cocaine addiction
mna05132  Salmonella infection
mna05133  Pertussis
mna05134  Legionellosis
mna05135  Yersinia infection
mna05140  Leishmaniasis
mna05142  Chagas disease
mna05145  Toxoplasmosis
mna05146  Amoebiasis
mna05152  Tuberculosis
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05162  Measles
mna05163  Human cytomegalovirus infection
mna05164  Influenza A
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05171  Coronavirus disease - COVID-19
mna05200  Pathways in cancer
mna05202  Transcriptional misregulation in cancer
mna05203  Viral carcinogenesis
mna05212  Pancreatic cancer
mna05215  Prostate cancer
mna05220  Chronic myeloid leukemia
mna05221  Acute myeloid leukemia
mna05222  Small cell lung cancer
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mna05321  Inflammatory bowel disease
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107533544 (RELA)
   04014 Ras signaling pathway
    107533544 (RELA)
   04064 NF-kappa B signaling pathway
    107533544 (RELA)
   04668 TNF signaling pathway
    107533544 (RELA)
   04066 HIF-1 signaling pathway
    107533544 (RELA)
   04071 Sphingolipid signaling pathway
    107533544 (RELA)
   04024 cAMP signaling pathway
    107533544 (RELA)
   04151 PI3K-Akt signaling pathway
    107533544 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    107533544 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    107533544 (RELA)
   04218 Cellular senescence
    107533544 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107533544 (RELA)
   04620 Toll-like receptor signaling pathway
    107533544 (RELA)
   04621 NOD-like receptor signaling pathway
    107533544 (RELA)
   04622 RIG-I-like receptor signaling pathway
    107533544 (RELA)
   04623 Cytosolic DNA-sensing pathway
    107533544 (RELA)
   04625 C-type lectin receptor signaling pathway
    107533544 (RELA)
   04660 T cell receptor signaling pathway
    107533544 (RELA)
   04658 Th1 and Th2 cell differentiation
    107533544 (RELA)
   04659 Th17 cell differentiation
    107533544 (RELA)
   04657 IL-17 signaling pathway
    107533544 (RELA)
   04662 B cell receptor signaling pathway
    107533544 (RELA)
   04062 Chemokine signaling pathway
    107533544 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107533544 (RELA)
   04917 Prolactin signaling pathway
    107533544 (RELA)
   04926 Relaxin signaling pathway
    107533544 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107533544 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107533544 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    107533544 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107533544 (RELA)
   05202 Transcriptional misregulation in cancer
    107533544 (RELA)
   05203 Viral carcinogenesis
    107533544 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107533544 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    107533544 (RELA)
   05221 Acute myeloid leukemia
    107533544 (RELA)
   05220 Chronic myeloid leukemia
    107533544 (RELA)
   05215 Prostate cancer
    107533544 (RELA)
   05222 Small cell lung cancer
    107533544 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    107533544 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107533544 (RELA)
   05022 Pathways of neurodegeneration - multiple diseases
    107533544 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    107533544 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107533544 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107533544 (RELA)
   04931 Insulin resistance
    107533544 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107533544 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107533544 (RELA)
   05135 Yersinia infection
    107533544 (RELA)
   05133 Pertussis
    107533544 (RELA)
   05134 Legionellosis
    107533544 (RELA)
   05152 Tuberculosis
    107533544 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107533544 (RELA)
   05170 Human immunodeficiency virus 1 infection
    107533544 (RELA)
   05161 Hepatitis B
    107533544 (RELA)
   05160 Hepatitis C
    107533544 (RELA)
   05171 Coronavirus disease - COVID-19
    107533544 (RELA)
   05164 Influenza A
    107533544 (RELA)
   05162 Measles
    107533544 (RELA)
   05168 Herpes simplex virus 1 infection
    107533544 (RELA)
   05163 Human cytomegalovirus infection
    107533544 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107533544 (RELA)
   05169 Epstein-Barr virus infection
    107533544 (RELA)
   05165 Human papillomavirus infection
    107533544 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107533544 (RELA)
   05145 Toxoplasmosis
    107533544 (RELA)
   05140 Leishmaniasis
    107533544 (RELA)
   05142 Chagas disease
    107533544 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    107533544 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107533544 (RELA)
Transcription factors [BR:mna03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    107533544 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 107533544
NCBI-ProteinID: XP_016063765
LinkDB
Position
Unknown
AA seq 550 aa
MYLTQFPLRIPDLFPLIFPSEPAQASGPYVEIIEQPKPRGMRFRYKCEGRSAGSIPGERS
TDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIH
SFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGR
PLRLAPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGP
GWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPD
TDDRHRIEEKRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPSRSSTSIPKPAPQPYAF
TPSLSTINFEEFSPMVFSPGQIPNQTSALAAAPAPAMASALVQAPAPVPVLASSLAQAVA
PPAPKPTQAGEGTLTEALLQLQFDADEDLGALLGNNTDPAVFTDLASVDNSEFQQMLNQG
VSMAPHTAEPMLMEYPEAITRLVTGSQNPPDPAPAPLGASGLPNGLLSGDEDFSSIADMD
FSALLSQISS
NT seq 1653 nt   +upstreamnt  +downstreamnt
atgtatctgactcagtttcctctcaggatcccggacctgttccccctcatcttcccctct
gagccagcccaggcctccgggccctacgtggagatcatcgagcagcccaagccgcggggc
atgcgcttccgctacaagtgcgagggccgctcagcaggcagtatccccggagagaggagc
acagacaccaccaagacccaccccaccattaagatcaatggctacacagggccagggaca
gttcgcatctccctggttactaaggacccccctcaccggcctcacccccatgagctcgtg
gggaaagactgtcgggatggcttctatgaggctgagctctgcccggaccgctgcatccac
agcttccagaacctggggatccagtgtgtgaagaagcgggacctggagcaggccatcagt
cagcgcatccagaccaacaacaaccccttccaagttcccatagaagagcagcgcggagac
tacgacttgaatgctgtgcggctctgcttccaggtgacagtgcgggacccatcaggcagg
cccctccgcctggcacctgtcctctctcatcccatctttgacaaccgggcccccaacaca
gccgagctcaagatctgccgagtgaaccgaaactccgggagctgccttgggggggatgag
atcttcctgctgtgtgacaaggtgcagaaagaggacattgaagtgtatttcacgggacca
ggctgggaggcccgaggctccttttcacaagctgatgtacaccggcaagtggccattgtg
ttccggacacctccctatgcggaccctagcctgcaggccccagtgcgtgtctctatgcag
ctgcggcggccttcagatcgggagctcagtgagcccatggaattccagtacctcccagac
acagatgatcgtcaccggattgaggagaaacgcaaaaggacatatgagaccttcaagagc
atcatgaaaaagagtcctttcaatggacccacggacccccggccacctcctcggcgcatt
gctgtgccctcccgtagctcaacttccatccctaagcctgcaccccagccctatgccttt
acgccatccctcagcaccatcaactttgaggagttttcccccatggtcttctctcctggg
cagatcccaaaccagacctcagccttggcagcagcccctgccccagccatggcatcagct
ctggttcaggccccagcccctgtcccagtcctagcctccagccttgctcaggctgtagcc
ccgcctgcccccaagcccacccaggcaggggaagggacactgacggaggccctgctacag
ctgcagtttgatgctgatgaagacctgggggccctgttgggcaataacactgacccagcc
gtgttcacagacctggcatccgtcgacaactctgagtttcagcaaatgctgaaccagggt
gtgtctatggccccacacacagcggagcccatgctgatggagtaccctgaggctataaca
cgcctggttacagggtcccagaatccccctgacccagctcccgctccccttggggcctct
gggctccccaacggccttctctcaggggatgaagacttctcctccattgcagacatggac
ttctcagcccttctgagtcagatcagctcctaa

KEGG   Miniopterus natalensis: 107545508
Entry
107545508         CDS       T05883                                 

Gene name
NFKB1
Definition
(RefSeq) nuclear factor NF-kappa-B p105 subunit isoform X1
  KO
K02580  nuclear factor NF-kappa-B p105 subunit
Organism
mna  Miniopterus natalensis
Pathway
mna01523  Antifolate resistance
mna04010  MAPK signaling pathway
mna04014  Ras signaling pathway
mna04024  cAMP signaling pathway
mna04062  Chemokine signaling pathway
mna04064  NF-kappa B signaling pathway
mna04066  HIF-1 signaling pathway
mna04071  Sphingolipid signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04210  Apoptosis
mna04211  Longevity regulating pathway
mna04218  Cellular senescence
mna04380  Osteoclast differentiation
mna04613  Neutrophil extracellular trap formation
mna04620  Toll-like receptor signaling pathway
mna04621  NOD-like receptor signaling pathway
mna04622  RIG-I-like receptor signaling pathway
mna04623  Cytosolic DNA-sensing pathway
mna04625  C-type lectin receptor signaling pathway
mna04657  IL-17 signaling pathway
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna04660  T cell receptor signaling pathway
mna04662  B cell receptor signaling pathway
mna04668  TNF signaling pathway
mna04722  Neurotrophin signaling pathway
mna04917  Prolactin signaling pathway
mna04920  Adipocytokine signaling pathway
mna04926  Relaxin signaling pathway
mna04931  Insulin resistance
mna04932  Non-alcoholic fatty liver disease
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05030  Cocaine addiction
mna05132  Salmonella infection
mna05133  Pertussis
mna05134  Legionellosis
mna05135  Yersinia infection
mna05140  Leishmaniasis
mna05142  Chagas disease
mna05145  Toxoplasmosis
mna05146  Amoebiasis
mna05152  Tuberculosis
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05162  Measles
mna05163  Human cytomegalovirus infection
mna05164  Influenza A
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05171  Coronavirus disease - COVID-19
mna05200  Pathways in cancer
mna05202  Transcriptional misregulation in cancer
mna05203  Viral carcinogenesis
mna05206  MicroRNAs in cancer
mna05212  Pancreatic cancer
mna05215  Prostate cancer
mna05220  Chronic myeloid leukemia
mna05221  Acute myeloid leukemia
mna05222  Small cell lung cancer
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mna05321  Inflammatory bowel disease
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107545508 (NFKB1)
   04014 Ras signaling pathway
    107545508 (NFKB1)
   04064 NF-kappa B signaling pathway
    107545508 (NFKB1)
   04668 TNF signaling pathway
    107545508 (NFKB1)
   04066 HIF-1 signaling pathway
    107545508 (NFKB1)
   04071 Sphingolipid signaling pathway
    107545508 (NFKB1)
   04024 cAMP signaling pathway
    107545508 (NFKB1)
   04151 PI3K-Akt signaling pathway
    107545508 (NFKB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107545508 (NFKB1)
   04218 Cellular senescence
    107545508 (NFKB1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107545508 (NFKB1)
   04620 Toll-like receptor signaling pathway
    107545508 (NFKB1)
   04621 NOD-like receptor signaling pathway
    107545508 (NFKB1)
   04622 RIG-I-like receptor signaling pathway
    107545508 (NFKB1)
   04623 Cytosolic DNA-sensing pathway
    107545508 (NFKB1)
   04625 C-type lectin receptor signaling pathway
    107545508 (NFKB1)
   04660 T cell receptor signaling pathway
    107545508 (NFKB1)
   04658 Th1 and Th2 cell differentiation
    107545508 (NFKB1)
   04659 Th17 cell differentiation
    107545508 (NFKB1)
   04657 IL-17 signaling pathway
    107545508 (NFKB1)
   04662 B cell receptor signaling pathway
    107545508 (NFKB1)
   04062 Chemokine signaling pathway
    107545508 (NFKB1)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107545508 (NFKB1)
   04917 Prolactin signaling pathway
    107545508 (NFKB1)
   04926 Relaxin signaling pathway
    107545508 (NFKB1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107545508 (NFKB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107545508 (NFKB1)
  09149 Aging
   04211 Longevity regulating pathway
    107545508 (NFKB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107545508 (NFKB1)
   05202 Transcriptional misregulation in cancer
    107545508 (NFKB1)
   05206 MicroRNAs in cancer
    107545508 (NFKB1)
   05203 Viral carcinogenesis
    107545508 (NFKB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107545508 (NFKB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    107545508 (NFKB1)
   05221 Acute myeloid leukemia
    107545508 (NFKB1)
   05220 Chronic myeloid leukemia
    107545508 (NFKB1)
   05215 Prostate cancer
    107545508 (NFKB1)
   05222 Small cell lung cancer
    107545508 (NFKB1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    107545508 (NFKB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107545508 (NFKB1)
   05022 Pathways of neurodegeneration - multiple diseases
    107545508 (NFKB1)
  09165 Substance dependence
   05030 Cocaine addiction
    107545508 (NFKB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107545508 (NFKB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107545508 (NFKB1)
   04931 Insulin resistance
    107545508 (NFKB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107545508 (NFKB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107545508 (NFKB1)
   05135 Yersinia infection
    107545508 (NFKB1)
   05133 Pertussis
    107545508 (NFKB1)
   05134 Legionellosis
    107545508 (NFKB1)
   05152 Tuberculosis
    107545508 (NFKB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107545508 (NFKB1)
   05170 Human immunodeficiency virus 1 infection
    107545508 (NFKB1)
   05161 Hepatitis B
    107545508 (NFKB1)
   05160 Hepatitis C
    107545508 (NFKB1)
   05171 Coronavirus disease - COVID-19
    107545508 (NFKB1)
   05164 Influenza A
    107545508 (NFKB1)
   05162 Measles
    107545508 (NFKB1)
   05168 Herpes simplex virus 1 infection
    107545508 (NFKB1)
   05163 Human cytomegalovirus infection
    107545508 (NFKB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107545508 (NFKB1)
   05169 Epstein-Barr virus infection
    107545508 (NFKB1)
   05165 Human papillomavirus infection
    107545508 (NFKB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107545508 (NFKB1)
   05145 Toxoplasmosis
    107545508 (NFKB1)
   05140 Leishmaniasis
    107545508 (NFKB1)
   05142 Chagas disease
    107545508 (NFKB1)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    107545508 (NFKB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107545508 (NFKB1)
Transcription factors [BR:mna03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    107545508 (NFKB1)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer Ank_2 Ank_4 Ank Ank_3 Ank_5 Death
Other DBs
NCBI-GeneID: 107545508
NCBI-ProteinID: XP_016079084
LinkDB
Position
Unknown
AA seq 971 aa
MAEEDPYLGGHEQMFHLDPLNHTIFNSEIFQPEMPLPTADVPYLQILEQPKQRGFRFRYV
CEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKSTHLHAHSLVGKHCED
GICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLDYLQA
EGGGDRQLTDREKEIIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIY
DSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGIWEGFGDF
SPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQ
RKRQKLMPNFSDSFGGGGGAGAGGGGMYGTGGGGGGAGSTGPGYGFPHYGFPTYSGITFH
PGTTKSNAGMKHGTMDTSSKNGPEGCDKSDDREAVSPSGKVTETTEQDKGSGDRDDAVTL
TYPVGVKEESSGLQDNLFLEKALQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQDENG
DCVLHLAIIHLHAQLVRDLLEVTSGLVLDDIINMRNDLYQTPLHLAVITKQEAVVEDLLR
AGADLSLLDRLGNSVLHLAAKEGHEKILSILLKHKKAALLIDNPNGEGLTAIHIAVLSNS
MPCLLLLLAAGVDVNAPEQKSGRTALHLAVEQDNISLAGCLLLEGDAHVDSTTYDGTTPL
HIAAGRGSTRMAALLKAAGADPLLENFEPLYDLDDSWAKDGDDEGVVPGTTPLDMATNWQ
VFDILNGKPYEPEFTPDDLLAQGDMKQLTEDTKLQLYKLLEFPDPDKNWSTLAQKLGLGI
LNNAFRLSPAPSKTLMDNYEVSGGTIRELMEALRQMGYTEAIEVIQAAFTSGTAAPSPTK
TTTQANSLPLSPASTRQQIDELRDDSICDSGVETSFRKLSFTESLTSGSSLLTLNKMPHD
YGQEGPLEGKI
NT seq 2916 nt   +upstreamnt  +downstreamnt
atggcagaagaggatccgtatttgggagggcatgaacaaatgtttcatttggatcctttg
aatcatacaatatttaactcagaaatatttcaaccagagatgccactgccaacggcagat
gtcccataccttcaaatattagagcaacctaaacagagaggatttcgtttccgatatgtc
tgtgaaggcccgtcccatggtggactccctggtgcatccagtgaaaagaataagaagtcc
taccctcaggtcaaaatctgcaactatgtgggacctgcaaaggtgattgttcagttggtc
acaaatggaaaaagcacccacctgcatgcacacagcctggtggggaagcactgcgaggat
gggatctgcaccgtaactgctggacccaaggacatggtggtcggctttgcaaacctgggt
atacttcatgtgacaaagaaaaaagtatttgaaacactggaagcacgaatgacagaggca
tgtataaggggctataatcccggacttttggtgcatcctgatcttgactatttacaagca
gaaggtggaggagaccggcagctcacagatcgggaaaaggagatcatccgccaggcagct
ctgcagcagacaaaggagatggacctcagcgtggtgcggctcatgtttacagctttcctt
ccagacagcaccggtagcttcaccaggcgcctggaacccgtggtatcagacgccatctac
gacagcaaagcccccaatgcgtccaacttgaaaattgtacgaatggacaggacggctgga
tgcgtaactggaggggaagagatttatcttctctgtgacaaggttcagaaagatgacatc
cagattcgattttatgaagaggaggaaaatggtggaatctgggaaggatttggagatttt
tccccaacagatgttcatagacaatttgccatcgtcttcaaaacaccgaagtataaagac
gtcaacattaccaaaccagcctccgtgttcgtccagcttcggaggaaatctgatttggaa
actagcgaaccaaaaccttttctctactaccctgaaatcaaagataaagaggaagtgcag
aggaagcggcagaagctcatgcccaacttctcggacagttttggcggcggtggtggtgcc
ggggctggaggtggaggcatgtacggcactggcggtggaggagggggcgctgggagcacc
ggcccagggtatggcttcccccactatggatttccaacatacagtggaattaccttccac
cctggaaccactaaatctaatgctgggatgaagcatggaaccatggacacctcatctaaa
aatggccctgaaggttgtgacaagagtgatgacagagaggctgtaagtccctctgggaaa
gtaactgaaaccacagaacaagataaggggtctggagatagggatgatgcggttactctg
acgtatccagtgggagtaaaggaagagagctctgggcttcaggataatctcttcctagag
aaggctctgcagcttgccaagcggcatgccaacgccctgttcgactacgcggtgacagga
gatgtgaagatgctgctggctgtgcagcgccatctcactgccgtgcaggatgagaacggg
gactgtgtcctacacttagcaatcatccaccttcatgctcagcttgtgagggatctgcta
gaagtcacatctggtttggttttggatgacattatcaacatgagaaatgatctctaccag
acgcccttgcacttggcagtgatcaccaagcaggaggctgtggtggaggacttgctgagg
gctggggccgacctgagcctcctggaccgcttgggtaactcggttttgcacctagctgcc
aaagaaggacatgagaaaattctcagtattttactcaagcacaaaaaggcagcactactt
atcgacaaccccaatggggaaggtctgaccgccatccacatagccgtgctgagcaacagc
atgccgtgtctgctgctgctgctggctgccggggtggacgtgaacgcgccggagcagaag
tcgggccgcacggcgctgcacctggctgtggagcaggacaacatctccttggccggctgt
ctgctcctggagggtgatgcccatgtagacagtaccacctatgatggaaccacacccctg
cacatagcagccgggagaggctccacccggatggcagctcttctcaaagcagcaggagca
gatcccctgctggagaactttgagcctctctatgacctggatgactcttgggcaaaggat
ggagatgatgaaggagttgtgcctggaaccacacctctagatatggccaccaactggcag
gtattcgacatattaaatgggaaaccatatgagccagagtttacacctgatgatttactg
gcacaaggagacatgaaacagctgactgaagatacaaagctgcagctctacaagttgcta
gaatttcctgatccagacaaaaactggtctactctggcccagaaattaggtctggggata
ctcaataatgccttccgcctgagtcccgcgccttctaaaactctcatggacaattacgag
gtctctggaggaacaataagagagctgatggaggccctgagacagatgggctacaccgaa
gcgatcgaagtgatccaggcagccttcacctcaggaacggcagcccccagcccaaccaag
accaccactcaggccaactcgctgcctctctctcctgcctccacaagacagcaaatagat
gagctgcgagacgacagcatctgtgacagcggtgtggagacatccttccgcaaactcagc
ttcacggagtctctgaccagcggcagctcactgctgactcttaacaaaatgccccatgat
tacgggcaggaaggacctctagaaggcaaaatttag

DBGET integrated database retrieval system