KEGG   Miniopterus natalensis: 107533587
Entry
107533587         CDS       T05883                                 

Gene name
ADRBK1
Definition
(RefSeq) beta-adrenergic receptor kinase 1
  KO
K00910  beta-adrenergic-receptor kinase [EC:2.7.11.15]
Organism
mna  Miniopterus natalensis
Pathway
mna04062  Chemokine signaling pathway
mna04144  Endocytosis
mna04340  Hedgehog signaling pathway
mna04724  Glutamatergic synapse
mna04740  Olfactory transduction
mna05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    107533587 (ADRBK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107533587 (ADRBK1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107533587 (ADRBK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    107533587 (ADRBK1)
  09157 Sensory system
   04740 Olfactory transduction
    107533587 (ADRBK1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107533587 (ADRBK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107533587 (ADRBK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107533587 (ADRBK1)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.15  beta-adrenergic-receptor kinase
     107533587 (ADRBK1)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   107533587 (ADRBK1)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107533587 (ADRBK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS PH Kinase-like Pkinase_fungal DUF5647 ATG16
Other DBs
NCBI-GeneID: 107533587
NCBI-ProteinID: XP_016063822
LinkDB
Position
Unknown
AA seq 647 aa
MQKYLEDRGEVTFEKIFSQKLGYLLFRDFCLKHLEEAKPLVEFYEEIKKYEKLETEEERL
TCSREIFDTYIMKELLACSHPFSKSAIEHVQGHLVKRQVPPDLFQPYIEEICQNLRGDVF
QKFIESDKFTRFCQWKNVELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCL
DKKRIKMKQGETLALNERIMLSLVSTGDCPFIVCMSYAFHTPDKLSFILDLMNGGDLHYH
LSQHGVFSEADMRFYAAEIILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDF
SKKKPHASVGTHGYMAPEVLQKGVAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEI
DRMTLTMAVELPDSFSPELRSLLEGLLQRDVHRRLGCLGRGAQEVKESPFFHSLDWQMVF
LQKYPPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLLDSDQELYRNFPLTISERWQQEVA
ETVFDTINAETDRLETRKKTKNKQLGHEEDYALGKDCIMHGYMSKMGNPFLTQWQRRYFY
LFPNRLEWRGEGEAPQSLLTMEEIQSVEETQIKERKCLLLKIRGGKQFVLQCDSDPELVQ
WKKELRDAYREAQQLVQRVPKMKNKARSPVVELSKVPLVQRGSANGL
NT seq 1944 nt   +upstreamnt  +downstreamnt
atgcagaagtacctggaggaccggggcgaggtgacctttgagaagatcttctcccagaaa
ctggggtacctgctcttccgagacttctgcctgaaacacctggaggaggccaagcccttg
gtggagttctacgaggagatcaagaaatacgagaagctggagacagaggaggagcgcctg
acctgcagccgggagatcttcgacacctacatcatgaaggagctgctggcctgctcgcac
cccttctcgaaaagtgccattgagcacgtccagggccatctggtgaagaggcaggtgcct
ccggatctcttccagccgtacatcgaggagatttgtcagaacctccgaggggacgtgttc
cagaaattcattgagagtgataaattcacacgattttgccagtggaagaatgtggagctc
aacatccatctgaccatgaatgacttcagtgtgcaccgcatcattggtcgagggggcttc
ggcgaggtctatgggtgccggaaggctgacacgggcaagatgtatgccatgaagtgtctg
gacaagaaacgcatcaagatgaaacagggggagaccctggccctgaacgagcgcatcatg
ctgtccctcgtcagcactggggactgcccgtttatcgtctgcatgtcgtacgcattccac
acgccggacaaactcagcttcatcctagatctcatgaacggtggggacctgcactatcac
ctgtcccagcatggggtcttttccgaagcggacatgcgcttctacgcagccgagatcatc
ctgggcctggagcacatgcacaatcgctttgtcgtctacagggacctgaagccggccaac
atcctgctggacgagcacggccacgtgcgcatctcagacctgggcctggcctgcgacttc
tccaagaagaagccccacgccagcgtgggcacccatgggtacatggctcccgaggtgctg
cagaagggagtggcctatgacagcagtgccgactggttctccctgggctgcatgctcttc
aagctgctgcgggggcatagtcccttccggcagcataagaccaaagacaagcatgagatt
gaccggatgacattgacaatggctgtggagctgcccgactccttctcccctgagctccgt
tccttgctggaggggctattgcagagggatgtccacaggagactgggctgcctgggccga
ggggcccaggaggtgaaggagagccccttcttccactccctagactggcagatggtcttc
ttgcagaagtaccctcccccgctgatccccccacgaggggaggtgaacgcagctgacgcc
ttcgacatcggctcctttgatgaggaagacacaaaaggaatcaagttgctggacagcgac
caggagctctaccgcaacttccccctcaccatctctgagcggtggcagcaggaggtggca
gagactgtcttcgacaccatcaacgctgagacagatcggctggagacccgcaagaaaacc
aaaaacaagcagctgggccatgaggaagactacgccctgggcaaagactgcatcatgcac
ggctacatgtccaagatgggcaaccctttcctgacccagtggcagcggcggtacttctac
ctgttccccaacaggctcgagtggcggggcgagggcgaggccccgcagagcctgctaacc
atggaggagatccagtcggtggaggagacgcagatcaaggagcgaaagtgcctccttctc
aagatccgcggtggtaaacagttcgtcctgcagtgtgatagtgacccggagctggtgcag
tggaagaaagagctgcgcgacgcttaccgagaggcccagcagctggtgcagcgggtgccc
aagatgaagaacaaggcccgctcgcccgtggtggagctgagcaaggtgccgctggtgcag
cgtggcagtgccaacggcctctga

KEGG   Miniopterus natalensis: 107533866
Entry
107533866         CDS       T05883                                 

Gene name
ADRBK2
Definition
(RefSeq) beta-adrenergic receptor kinase 2 isoform X1
  KO
K00910  beta-adrenergic-receptor kinase [EC:2.7.11.15]
Organism
mna  Miniopterus natalensis
Pathway
mna04062  Chemokine signaling pathway
mna04144  Endocytosis
mna04340  Hedgehog signaling pathway
mna04724  Glutamatergic synapse
mna04740  Olfactory transduction
mna05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    107533866 (ADRBK2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107533866 (ADRBK2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107533866 (ADRBK2)
  09156 Nervous system
   04724 Glutamatergic synapse
    107533866 (ADRBK2)
  09157 Sensory system
   04740 Olfactory transduction
    107533866 (ADRBK2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107533866 (ADRBK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107533866 (ADRBK2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107533866 (ADRBK2)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.15  beta-adrenergic-receptor kinase
     107533866 (ADRBK2)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   107533866 (ADRBK2)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107533866 (ADRBK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS PH Kinase-like HTH_WhiA Pkinase_fungal
Other DBs
NCBI-GeneID: 107533866
NCBI-ProteinID: XP_016064213
LinkDB
Position
Unknown
AA seq 646 aa
MQKYLEERNEITFDKIFNQKIGFLLFKDFCLNEINEAVPQVKFYEEIKEYEKLDNEEDRL
CRSRQIYDTYIMKELLSCSHPFSKQAVDHVQNHLSKKQVTSTLFQPYIEEICESLRGNIF
QKFMESDKFTRFCQWKNVELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCL
DKKRIKMKQGETLALNERIMLSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGGDLHYH
LSQHGVFSEKEMRFYATEIILGLEHMHNRFVVYRDLKPANILLDEYGHVRISDLGLACDF
SKKKPHASVGTHGYMAPEVLQKGTAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEI
DRMTLTVNVELPDTFSPELKSLLEGLLQREVSKRLGCRGGGAREVKEHGFFKGIDWQHVY
LQKYPPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLLDCDQELYKNFPLVISERWQQEVV
ETIYETVNADTDKIEARKRAKHKQLGHEEDYAMGKDCIMHGYMLKLGNPFLTQWQRRYFY
LFPNRLEWRGEGDSRQNLLTMEQILSVEETQIKDKKCILLRIKGGKQFVLQCESDPEFVQ
WKKELTETFTEAQRLLRRAPKFLNKSRAGVLELAKPPLCHRNSNGL
NT seq 1941 nt   +upstreamnt  +downstreamnt
atgcagaagtatcttgaggagagaaacgaaataacctttgacaagattttcaatcagaaa
attggtttcttgctatttaaagatttttgtttgaatgaaattaatgaagctgtacctcag
gtgaagttttatgaagagataaaagaatacgaaaagcttgacaacgaggaagatcgcctt
tgtaggagtcgacagatttacgacacctatatcatgaaggagctgctgtcctgctcgcac
ccattctcaaaacaagctgtagaccatgtacagaatcatctgtccaagaaacaagtgacg
tcaactctcttccagccatacatagaagaaatttgtgaaagtcttcgaggcaacattttt
caaaaatttatggaaagtgacaagttcactagattttgccagtggaaaaacgtagaatta
aatatccatctgaccatgaatgatttcagcgtgcacaggatcatcgggcgaggcggcttt
ggagaagtgtacggttgcaggaaagcagacaccggaaaaatgtatgcaatgaagtgcctg
gataagaagcggatcaagatgaaacaaggagagaccttagccttaaatgaaaggattatg
ctgtcgcttgttagtacgggagattgtcctttcattgtctgcatgacctacgccttccac
acgccagataaactctgcttcatcttggacctgatgaatgggggcgatttgcactatcac
ctgtcacagcacggggtgttttctgagaaggagatgcgtttctacgccaccgagatcatc
ctggggctggagcacatgcacaaccggttcgtcgtgtacagagacctgaagcccgcaaac
atcctcttggatgagtacggacatgtcaggatatcagacctcggccttgcctgtgatttc
tccaaaaagaagccgcacgcgagcgtgggcacccatgggtacatggccccggaggtgctg
cagaaggggactgcgtacgatagcagtgccgactggttctccctgggctgcatgctgttc
aagctcctgcgaggtcacagccctttcagacaacataaaaccaaagataagcatgaaata
gaccggatgacactgaccgtgaacgtggagcttccagacaccttctccccggagctgaag
tccctcctggagggtttgctccagcgcgaagttagcaagcggctcggctgtcgcggaggc
ggcgcgcgggaggtgaaggagcacggcttcttcaagggcatcgactggcagcacgtctac
ttgcagaagtacccgccacccttgattcctccccggggagaggtgaacgccgctgacgcc
tttgacatcggctccttcgatgaagaggacaccaagggcatcaagcttctcgattgcgac
caagagctctacaagaacttcccgttggtgatctccgagcgctggcagcaggaagtcgtg
gaaaccatttatgaaaccgtgaacgcggacacggataaaatcgaggccaggaagagagcg
aagcacaagcagctgggccacgaagaagattacgccatggggaaagactgcataatgcat
ggctacatgctgaagctgggaaacccgttcctcacacagtggcaacgtcggtatttttac
ctctttccgaacagactggagtggagaggagagggggactcccggcaaaatttgctgaca
atggaacagatcctgtctgtggaggaaactcagatcaaggacaaaaaatgcattttgttg
aggataaaaggagggaagcagtttgtcttgcagtgtgagagtgacccggagtttgtgcag
tggaagaaggagctgacggagaccttcacggaggcccagcggctgctgcgacgcgccccc
aagttcctcaacaagtcccgggcgggcgtcctggagctcgccaagccgcccctctgtcac
aggaacagcaacggcctctga

DBGET integrated database retrieval system