KEGG   Miniopterus natalensis: 107533656
Entry
107533656         CDS       T05883                                 

Gene name
PDE2A
Definition
(RefSeq) cGMP-dependent 3',5'-cyclic phosphodiesterase
  KO
K18283  cGMP-dependent 3',5'-cyclic phosphodiesterase [EC:3.1.4.17]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna01100  Metabolic pathways
mna04022  cGMP-PKG signaling pathway
mna04740  Olfactory transduction
mna04925  Aldosterone synthesis and secretion
mna05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107533656 (PDE2A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    107533656 (PDE2A)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    107533656 (PDE2A)
  09157 Sensory system
   04740 Olfactory transduction
    107533656 (PDE2A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107533656 (PDE2A)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     107533656 (PDE2A)
SSDB
Motif
Pfam: PDEase_I GAF GAF_2 GAF_3
Other DBs
NCBI-GeneID: 107533656
NCBI-ProteinID: XP_016063927
LinkDB
Position
Unknown
AA seq 941 aa
MVLSGPTSNHRATDPGIPVLRALGSGLSSEFLKLIWDHSDLPFPLFQDALLSLGSVIDIA
GLRQAVKEAISAVLPRVETVYTYLLDRESRLVCEDPPHELPQEGKVREAVISRKRLGCNG
LGLSDLPGKPLAKLVAPLAPDTQVLVIPLADKETGAVAAVILVHCGQLSDSEEWSLQAVE
KHTLVALRRVQALQQRRPGVAPEAVQTPPAGTAGDEKGXAAYTYRDGKILQLCGELYDLD
ASSLQLKVLQYLQQETHASRCCLLLVSEDNLQLSCKVIGDKVLEEDVSFPLTMGRLGQVM
EDKESIQLKDLTSEDVRQLQNMLGCELQTMLCVPVISRATDQVVALACAFNKLGGDSFTD
QDKHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITE
ARNLSNAEICSVFLLDQNELVAKVFDGGVVEDESYEIRIPADQGIAGHVATTGQILNIPD
AYAHPLFYRGVDDSTGFRTRNILCFPIKNENKEVIGVAELVNKINGPWFSKFDEDLATAF
SIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVASIDSNF
ASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMH
AFSVSHFCYLLYKNLELTNYLEDIEIFALFVSCMCHDLDHRGTNNSFQVASKSVLAALYS
SEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDL
QKMAEVGYDRTNKQHHSLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAM
GNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSH
KFTIRGLPSNNSLDFLDEEYEVPELDGTRGPVNGCCSLDTE
NT seq 2826 nt   +upstreamnt  +downstreamnt
atggtgctgagtggccctacctccaaccacagagctacagatcctggaattccagttctg
agagccttgggctctggtttaagctcggagtttctaaagctcatatgggaccactctgac
ctgccctttcctctcttccaggatgctttgctgagcctgggctctgtcatcgacattgca
ggcttgcgccaggctgtcaaggaggccatttcagccgtgctccccagagtggagactgtc
tacacctacctgttggacagggagtcgcggctggtgtgtgaggaccctccccacgagctg
ccccaggaaggaaaagtgcgagaggctgtgatctcccggaagcggctgggttgtaatgga
ctggggctctcggacctgcctgggaagcctttggccaagctggtggccccactggctcct
gacacccaagtgctggtcataccgctggcggacaaggagactggggctgtggcagctgtc
atcttggtgcactgtggccagctgagtgacagtgaagagtggagccttcaagcagtggag
aagcataccctggtggccctgcggagggtgcaggccctgcagcagcgccggcccggcgtg
gcccccgaagctgtccagacgcccccggcggggacggcgggagacgagaagggnnnggcg
gcgtacacctaccgggacgggaaaatcctgcaactgtgcggggagctctacgacctggac
gcctcttccctgcagctgaaagtcctccaatacctgcagcaggagactcatgcatcccgc
tgctgcctcctgctggtgtccgaggacaatctacagctctcctgtaaggtcatcggagat
aaagtgctggaggaagatgtcagctttccgttgacgatgggacgcctgggccaggtgatg
gaagacaaggagtctatccagctgaaagatctcacctcagaggatgtgcgacagctgcaa
aacatgttgggctgtgagctgcagaccatgctctgtgtccctgtcatcagccgggccacg
gaccaggtggtggccttggcctgtgccttcaacaagctcggaggagactcattcaccgac
caggacaaacatgtgatccagcattgctttcactacaccagcacggtgctcaccagcacc
ctggcattccagaaggagcagaagctcaagtgtgagtgccaggctcttcttcaagtggca
aagaacctcttcactcacctggatgacgtctctgtcctgctccaggagatcatcacagag
gccagaaacctcagcaatgctgagatctgctccgtgttcctgctggatcaaaatgagctg
gtggccaaggtgttcgacgggggcgttgtggaggacgagagctatgagatacgcatcccg
gccgatcagggcatagcgggccacgtggcgactacaggccagatcctgaacatcccggac
gcatacgcgcacccgcttttctaccgcggtgtggacgacagcacgggtttccgcacgcgc
aacatcctctgcttccccatcaagaacgagaacaaggaggtcatcggtgtggccgagctg
gtgaacaagatcaatggaccatggttcagcaagttcgatgaggacctggccacggccttc
tccatctactgcggcatcagcatcgcccattccctcctttacaagaaagtgaatgaggcc
cagtatcgcagccacctcgccaatgagatgatgatgtaccacatgaaggtctctgatgat
gaatataccaaacttctccatgatgggatccagcccgtggcttccattgactccaacttc
gccagtttcacctacacccctcgctctcttcccgaggatgacacttccatggccatcctc
agcatgctgcaggacatgaatttcatcaacaactataaaattgactgcccgacactggcc
cggttctgtttgatggtaaagaagggctaccgggacccaccctaccacaactggatgcac
gccttctctgtctctcacttctgctacctgctctacaagaacctggagctcaccaactac
ctcgaggacatcgagatctttgccttgtttgtttcctgcatgtgtcatgacctggaccac
agaggcacaaacaactccttccaggtggcctcgaaatctgtgctggctgcgctctacagc
tctgagggctctgtcatggagaggcaccacttcgctcaggccatcgccatcctcaacacc
catggttgcaacatcttcgaccacttctcccggaaggactatcagcgtatgctggacctg
atgagagacatcatcctggccacagacctggcccaccacctgcgcatctttaaggacctc
cagaagatggctgaagtgggctatgatcgaaccaataagcagcaccacagcctcctcctc
tgcctccttatgacctcctgtgacctctctgaccagaccaagggctggaagaccacaagg
aagattgcagagctgatctacaaagagttcttctcccagggagatttggagaaggccatg
ggcaacaggccaatggagatgatggaccgtgagaaggcttacatccctgagctgcagatc
agcttcatggagcacatcgcaatgcccatctacaagctgctgcaggacctgttccccaaa
gcggcagagctgtatgaacgcgtggcctctaaccgtgagcactggaccaaggtgtcgcac
aagttcaccatccgaggcctcccgagcaacaactcactggacttcctggatgaggaatat
gaggtgcctgagctagatggcactaggggccctgtcaatggctgttgcagccttgacact
gagtga

DBGET integrated database retrieval system