KEGG   Miniopterus natalensis: 107533720
Entry
107533720         CDS       T05883                                 

Gene name
TPM1
Definition
(RefSeq) tropomyosin alpha-1 chain
  KO
K10373  tropomyosin 1
Organism
mna  Miniopterus natalensis
Pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna05206  MicroRNAs in cancer
mna05410  Hypertrophic cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107533720 (TPM1)
   04261 Adrenergic signaling in cardiomyocytes
    107533720 (TPM1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    107533720 (TPM1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107533720 (TPM1)
   05414 Dilated cardiomyopathy
    107533720 (TPM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107533720 (TPM1)
   04147 Exosome [BR:mna04147]
    107533720 (TPM1)
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     107533720 (TPM1)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   107533720 (TPM1)
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II TMF_DNA_bd ERM NBP1 DUF745 DHR10 COG2 EzrA Lebercilin DUF1664 SlyX CENP-F_leu_zip DUF16 Fib_alpha
Other DBs
NCBI-GeneID: 107533720
NCBI-ProteinID: XP_016063985
LinkDB
Position
Unknown
AA seq 327 aa
MGPFPCSNFPSRPVENIMKALYKWTLEEDIAAKEKLLRASEDERDRVLEELHRAEDSLLA
ADETAAKANSQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVAS
LNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQ
LKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGQVRQLEEQLRIMDQTLKAL
MAAEDKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKY
KAISEELDHALNDMTSIESGSCQRRKP
NT seq 984 nt   +upstreamnt  +downstreamnt
atgggccccttcccatgctccaacttcccctccaggcctgtggaaaatataatgaaggcc
ctctacaagtggactctagaggaggacatcgcggccaaggagaagctgctgcgggcgtcg
gaggacgagcgggaccgggtgctggaggagctgcaccgggccgaggacagcctcctggcc
gccgacgagaccgccgccaaggccaactcccagctggaagatgagctggtgtcgctacaa
aagaaactcaagggcactgaagatgaactggacaagtactccgaggctctcaaagatgcc
caggagaagctggaactggcagaaaaaaaggccaccgacgctgaagccgatgtagcttct
ctgaacagacgcatccagctggttgaggaagagttggatcgagcccaagagcgtctggca
acagctttgcagaaactggaggaggccgagaaggcagcagatgagagtgagagaggcatg
aaagtcattgaaagtcgagcccagaaagatgaagagaaaatggaaattcaggagatccaa
ctgaaagaggccaagcacattgctgaagatgccgaccgcaagtacgaagaggtggcccgt
aagctggtcatcattgagagtgacctggaacgtgcagaggagcgggccgagctctcagaa
ggccaagttcgacagctggaagaacaattaagaataatggatcagaccttgaaagcatta
atggctgcagaggataagtactctcagaaggaagacaaatatgaggaagagatcaaggtc
ctttctgacaagctgaaggaggctgagactcgggctgagtttgcagagaggtcagtaact
aaattggagaaaagcattgatgacttagaagacgagctgtacgctcagaaactgaagtac
aaggccatcagcgaggagctggaccacgctctcaacgatatgacttccatagaaagtggc
tcatgccaaagaagaaaaccttag

KEGG   Miniopterus natalensis: 107534317
Entry
107534317         CDS       T05883                                 

Gene name
TPM4
Definition
(RefSeq) tropomyosin alpha-4 chain isoform X1
  KO
K10375  tropomyosin 4
Organism
mna  Miniopterus natalensis
Pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna05410  Hypertrophic cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107534317 (TPM4)
   04261 Adrenergic signaling in cardiomyocytes
    107534317 (TPM4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107534317 (TPM4)
   05414 Dilated cardiomyopathy
    107534317 (TPM4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107534317 (TPM4)
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     107534317 (TPM4)
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 CLZ Laminin_II ERM DUF3450 Crescentin Laminin_I ATG16 CENP-F_leu_zip ADIP TMF_DNA_bd PspA_IM30 DUF1664 DHR10 FPP GAS HrpB7 DUF745 CCDC144C Spc7 AAA_13 Uds1 TPR_MLP1_2 FliJ DUF948
Other DBs
NCBI-GeneID: 107534317
NCBI-ProteinID: XP_016064850
LinkDB
Position
Unknown
AA seq 284 aa
MEAIKKKMQMLKLDKENAIDRAEQAESDKKAAEEKCKQVEEELTHLQKKLKGTEDELDKY
SENLKDAQEKLELTEKKASDAEGDVAALNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIENRAMKDEEKMEIQELQLKEAKHIAEEADRKYEEVARKLVILEGELERAE
ERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAE
FAERTVAKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNCI
NT seq 855 nt   +upstreamnt  +downstreamnt
atggaggccatcaagaagaagatgcagatgctcaaactggacaaggagaacgccattgac
cgagctgagcaggccgagtcagataagaaggctgctgaggagaagtgcaagcaggtggag
gaggagctgacgcatctccagaagaaactgaaggggaccgaggatgagctggacaagtac
tccgagaacctgaaggacgcacaagagaagctggagctgacagagaagaaggcctcggac
gctgaaggggatgtggcagctctcaatcgacgcatccagctcgttgaggaggagttggac
agggctcaagaacgactggccacggccctgcagaagctagaagaagcagaaaaggctgcc
gatgagagcgagagaggaatgaaggtgatagaaaaccgggccatgaaagatgaagagaag
atggagattcaggagttgcagctcaaagaggccaagcacattgcagaggaggctgaccgc
aaatacgaggaggtagctcgtaagttggtcatcctggagggcgagctggagagggcagag
gagcgtgccgaggtgtctgaactaaaatgtggtgacctggaagaagaacttaagaatgtc
actaacaacctgaagtctctggaggctgcctctgaaaagtattctgaaaaggaagataaa
tatgaagaggaaattaaacttctgtctgacaaactgaaagaggcggagacgcgtgctgaa
tttgcagagagaacagttgcaaaactggaaaagacaattgatgacctggaagaaaaactt
gcccaggccaaagaagagaacgtgggcttacatcagacactggatcagacactaaatgaa
cttaactgtatataa

KEGG   Miniopterus natalensis: 107543812
Entry
107543812         CDS       T05883                                 

Gene name
TPM3
Definition
(RefSeq) tropomyosin alpha-3 chain isoform X1
  KO
K09290  tropomyosin 3
Organism
mna  Miniopterus natalensis
Pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna05200  Pathways in cancer
mna05216  Thyroid cancer
mna05410  Hypertrophic cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107543812 (TPM3)
   04261 Adrenergic signaling in cardiomyocytes
    107543812 (TPM3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107543812 (TPM3)
  09162 Cancer: specific types
   05216 Thyroid cancer
    107543812 (TPM3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107543812 (TPM3)
   05414 Dilated cardiomyopathy
    107543812 (TPM3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107543812 (TPM3)
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     107543812 (TPM3)
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II TMF_DNA_bd CENP-F_leu_zip WES_acyltransf DUF745 EzrA DUF1664 Lebercilin BORCS7 MAD Fib_alpha Crescentin
Other DBs
NCBI-GeneID: 107543812
NCBI-ProteinID: XP_016076941
LinkDB
Position
Unknown
AA seq 248 aa
MAGITTIEAVKRKIQVLQQQADDAEERAERLQREVEGEKRAREQAEAEVASLNRRIQLVE
EELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAE
EADRKYEEVARKLVIIEGDLERTEERAELAESRCREMDEQIRLMDQNLKCLSAAEEKYSQ
KEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDKLKCTKEEHLCTQRMLDQ
TLLDLNEM
NT seq 747 nt   +upstreamnt  +downstreamnt
atggctgggatcaccaccattgaggcggtgaaacgcaagatccaagttctgcagcagcag
gccgatgatgcagaagagagggccgagcgcctccagcgggaagtggagggagaaaagcgg
gcccgggaacaggctgaggctgaggtggcctccttgaaccgtaggatccagctggttgaa
gaggagctggaccgtgctcaggagcgcctggccactgccctgcaaaagctggaggaagct
gagaaagctgcagatgagagcgagagaggtatgaaggttattgaaaaccgagctttaaaa
gatgaagaaaagatggaactccaggaaatccaactcaaagaagctaagcacattgcagaa
gaggcagataggaagtatgaagaggtggctcgtaagttggtgattattgagggtgacttg
gaacgcacagaggaacgagctgagctggcagagtcccgttgccgagagatggatgagcag
atcagactgatggaccagaacctgaagtgtctgagtgctgctgaagaaaagtactctcaa
aaagaagacaaatatgaggaagagataaagattcttactgacaaactcaaggaggcagag
acccgtgctgagtttgctgagagatcggtagccaagctggaaaagacaattgatgatttg
gaagataaactgaaatgcaccaaagaggaacatctttgtacacaaaggatgctggaccag
actctgcttgacctgaatgagatgtag

KEGG   Miniopterus natalensis: 107545025
Entry
107545025         CDS       T05883                                 

Gene name
TPM2
Definition
(RefSeq) tropomyosin beta chain isoform X1
  KO
K10374  tropomyosin 2
Organism
mna  Miniopterus natalensis
Pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna05410  Hypertrophic cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107545025 (TPM2)
   04261 Adrenergic signaling in cardiomyocytes
    107545025 (TPM2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107545025 (TPM2)
   05414 Dilated cardiomyopathy
    107545025 (TPM2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107545025 (TPM2)
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     107545025 (TPM2)
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 CLZ Laminin_II ERM Crescentin TMF_DNA_bd YscO CENP-F_leu_zip HrpB7 FlaC_arch ATG16 SlyX ADIP Suppressor_APC DUF16
Other DBs
NCBI-GeneID: 107545025
NCBI-ProteinID: XP_016078535
LinkDB
Position
Unknown
AA seq 284 aa
MDAIKKKMQMLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQALQKKLKGTEDEVEKY
SEAVKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIENRAMKDEEKMELQEMQLKEAKHIAEDSDRKYEEVARKLVILEGELERSE
ERAEVAESKCGDLEEELKIVTNNLKSLEAQADKYSTKEDKYEEEIKLLEEKLKEAETRAE
FAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALNDITSL
NT seq 855 nt   +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcagatgctaaagctggacaaggaaaatgccatcgac
cgcgccgagcaggccgaggccgacaagaagcaagctgaggaccgctgcaagcagctggag
gaggaacagcaggccctccagaagaagctgaaagggactgaggatgaggtggaaaagtat
tcagaggcagtgaaggacgcccaggagaaactggagctggccgagaagaaggctaccgac
gccgaggcagatgtggcctccctgaaccgccgcattcagctggtagaggaggagctggac
cgggcgcaggagcgcctggctacagccctgcaaaagctagaggaggctgagaaggcagct
gatgagagtgagagaggaatgaaggtcattgaaaaccgagccatgaaggatgaggaaaag
atggagctgcaggagatgcagctgaaggaggccaagcacatcgctgaggactcagatcgc
aaatatgaggaggtggccaggaagctggtgatcctggaaggagagctggagcgctcagaa
gagagagctgaggtggctgagagtaaatgtggggacctagaggaggagctgaaaattgtt
accaacaacttgaaatccctggaagcccaagcagacaagtattccaccaaagaagataaa
tatgaagaagagatcaaactgctggaggagaagctaaaggaggctgagacccgagcagag
tttgccgaaaggtctgtggcaaagttggagaaaaccatcgatgacctggaagacgaagtc
tatgcgcagaagatgaagtacaaggccatcagtgaggagctggacaacgcactcaatgac
atcacctctctctga

DBGET integrated database retrieval system