KEGG   Miniopterus natalensis: 107533821
Entry
107533821         CDS       T05883                                 

Gene name
FOS
Definition
(RefSeq) LOW QUALITY PROTEIN: proto-oncogene c-Fos
  KO
K04379  proto-oncogene protein c-fos
Organism
mna  Miniopterus natalensis
Pathway
mna01522  Endocrine resistance
mna04010  MAPK signaling pathway
mna04024  cAMP signaling pathway
mna04210  Apoptosis
mna04380  Osteoclast differentiation
mna04620  Toll-like receptor signaling pathway
mna04657  IL-17 signaling pathway
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna04660  T cell receptor signaling pathway
mna04662  B cell receptor signaling pathway
mna04668  TNF signaling pathway
mna04713  Circadian entrainment
mna04725  Cholinergic synapse
mna04728  Dopaminergic synapse
mna04915  Estrogen signaling pathway
mna04917  Prolactin signaling pathway
mna04921  Oxytocin signaling pathway
mna04926  Relaxin signaling pathway
mna04928  Parathyroid hormone synthesis, secretion and action
mna04932  Non-alcoholic fatty liver disease
mna04935  Growth hormone synthesis, secretion and action
mna05031  Amphetamine addiction
mna05132  Salmonella infection
mna05133  Pertussis
mna05135  Yersinia infection
mna05140  Leishmaniasis
mna05142  Chagas disease
mna05161  Hepatitis B
mna05162  Measles
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05171  Coronavirus disease - COVID-19
mna05200  Pathways in cancer
mna05210  Colorectal cancer
mna05224  Breast cancer
mna05231  Choline metabolism in cancer
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mna05323  Rheumatoid arthritis
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107533821 (FOS)
   04668 TNF signaling pathway
    107533821 (FOS)
   04024 cAMP signaling pathway
    107533821 (FOS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107533821 (FOS)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107533821 (FOS)
   04660 T cell receptor signaling pathway
    107533821 (FOS)
   04658 Th1 and Th2 cell differentiation
    107533821 (FOS)
   04659 Th17 cell differentiation
    107533821 (FOS)
   04657 IL-17 signaling pathway
    107533821 (FOS)
   04662 B cell receptor signaling pathway
    107533821 (FOS)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107533821 (FOS)
   04917 Prolactin signaling pathway
    107533821 (FOS)
   04921 Oxytocin signaling pathway
    107533821 (FOS)
   04926 Relaxin signaling pathway
    107533821 (FOS)
   04935 Growth hormone synthesis, secretion and action
    107533821 (FOS)
   04928 Parathyroid hormone synthesis, secretion and action
    107533821 (FOS)
  09156 Nervous system
   04725 Cholinergic synapse
    107533821 (FOS)
   04728 Dopaminergic synapse
    107533821 (FOS)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107533821 (FOS)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107533821 (FOS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107533821 (FOS)
   05231 Choline metabolism in cancer
    107533821 (FOS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107533821 (FOS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107533821 (FOS)
   05224 Breast cancer
    107533821 (FOS)
  09163 Immune disease
   05323 Rheumatoid arthritis
    107533821 (FOS)
  09165 Substance dependence
   05031 Amphetamine addiction
    107533821 (FOS)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107533821 (FOS)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107533821 (FOS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107533821 (FOS)
   05135 Yersinia infection
    107533821 (FOS)
   05133 Pertussis
    107533821 (FOS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107533821 (FOS)
   05170 Human immunodeficiency virus 1 infection
    107533821 (FOS)
   05161 Hepatitis B
    107533821 (FOS)
   05171 Coronavirus disease - COVID-19
    107533821 (FOS)
   05162 Measles
    107533821 (FOS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107533821 (FOS)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    107533821 (FOS)
   05142 Chagas disease
    107533821 (FOS)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107533821 (FOS)
Transcription factors [BR:mna03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    107533821 (FOS)
Membrane trafficking [BR:mna04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    107533821 (FOS)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF3450 UPF0242 Macoilin HALZ
Other DBs
NCBI-GeneID: 107533821
NCBI-ProteinID: XP_016064150
LinkDB
Position
Unknown
AA seq 389 aa
MMFSSFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLASSSANF
IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTETAGWIETAPQTRCQGAGKL
QGAWSRRQTRLLTFGLFSFXLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQ
LEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEELSVASLDLSGGLPEAA
NPESEEAFALPLLSDPEPKPSVEPIKNLSSVELKAEPFDDFLFPASSRPSGSETSRSVPD
MDLSGSFYAADWEPLHGGSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSY
PSCAAAHRKGSSSNEPSSDSLSSPTLLAL
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgatgttctcaagcttcaacgccgactacgaggcttcctcctcgcgctgcagcagcgct
tccccggctggcgacagcctgtcttactaccactccccggccgactccttctccagcatg
ggctctccggtcaacgcgcaggacttctgcacggacctggcatcctccagtgccaacttc
atcccgactgtgactgccatctcgaccagcccggacctgcagtggctggtgcagcccacc
ctcgtctcctccgtggccccatcccagaccagagccccccacccctacggagtccccact
gaaactgcgggttggatagaaacggctccacagacaaggtgccagggagctgggaagctg
cagggtgcatggagccgacggcagacgcggttactgaccttcggtcttttttccttctag
ttgtccccagaagaagaagagaagaggagaatccgaagggaaaggaataagatggctgca
gccaaatgccgaaaccggaggagggagctgaccgacacgctgcaagcggagacggaccag
ctagaagacgagaagtctgccttgcagaccgagatcgccaacctgctgaaggagaaggaa
aagctggagttcatcctggcggcgcaccggcctgcctgcaagatccccgacgacctgggc
ttcccggaggagctgtccgtggcttccctcgacctgagtggaggcctgcctgaggccgcc
aaccctgagtccgaggaggccttcgccctgcccctcctcagcgaccctgagcccaagccc
tccgtggagcccatcaaaaacctgagcagcgtggagctgaaggctgagcccttcgatgac
ttcctgttccccgcatcgtccaggcccagcggctctgagacctcccgctcggtgcccgac
atggacctgtctggttccttctatgcagcagactgggagcccctgcacggtggctccctg
gggatggggcccatggccacagagctggagcccctgtgcaccccggtggtcacctgcact
cccagctgcactacctacacgtcttccttcgtcttcacctaccccgaggccgactcctac
cccagctgtgcggccgcccaccgcaagggcagcagcagcaacgagccctcctctgactcg
ctcagctcacccacgttgctggccctgtga

DBGET integrated database retrieval system