KEGG   Miniopterus natalensis: 107533905
Entry
107533905         CDS       T05883                                 

Gene name
DRD1
Definition
(RefSeq) D(1A) dopamine receptor
  KO
K04144  dopamine receptor D1
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04024  cAMP signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04540  Gap junction
mna04728  Dopaminergic synapse
mna05012  Parkinson disease
mna05030  Cocaine addiction
mna05031  Amphetamine addiction
mna05032  Morphine addiction
mna05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107533905 (DRD1)
   04024 cAMP signaling pathway
    107533905 (DRD1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107533905 (DRD1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107533905 (DRD1)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    107533905 (DRD1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107533905 (DRD1)
  09165 Substance dependence
   05030 Cocaine addiction
    107533905 (DRD1)
   05031 Amphetamine addiction
    107533905 (DRD1)
   05032 Morphine addiction
    107533905 (DRD1)
   05034 Alcoholism
    107533905 (DRD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107533905 (DRD1)
G protein-coupled receptors [BR:mna04030]
 Rhodopsin family
  Biogenic amine
   Dopamine
    107533905 (DRD1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 107533905
NCBI-ProteinID: XP_016064267
LinkDB
Position
Unknown
AA seq 446 aa
MRTLNTSAMDRPGLAVERDFSVRILTACFLCLLILSTLLGNTLVCAAVIRFRHLRSKVTN
FFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVD
RYWAISSPFRYERKMTPKAAFVLISVAWTLSVLISFIPVQLSWHKAKPASPSDGNATSPG
EPADNCDSSLSRTYAISSSLISFYIPVAIMIVTYTRIYRIAQKQIRRISALERAAVHAKN
CQTTTGNGNPAECAQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCMVPFCGS
GETQPFCIDSITFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPTTGNAIET
VSINNNGAVVFSSHHEPRGSISKDCNLVYLIPHAVGSSEDPKRQEAGGVARPSEKLSPAL
SVILDYDTDVSLGKIQPITQNGQHPT
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgaggaccctgaacacctccgccatggacaggcccgggctggcggtggagagggacttc
tccgtccgcatcctcacagcctgtttcctgtgcctgctcatcctgtccacgctcctgggg
aacactctggtctgcgccgccgtcatcaggttccggcacctgcggtccaaggtgaccaac
ttcttcgtcatctccttggccgtgtctgacctcctggtggctgtcttggtcatgccctgg
aaggcggtggccgagatcgccggcttctggccctttgggtccttctgtaacatctgggtg
gcctttgacatcatgtgctccacggcgtccatcctcaacctctgcgtgatcagcgtggac
aggtactgggccatctccagccccttccggtacgagaggaagatgacacccaaggcagcc
ttcgttctgatcagcgtggcgtggaccttgtccgtgctcatttccttcattcccgtgcag
ctcagctggcacaaggcaaaacccgcgagcccctccgacgggaacgccacttccccgggc
gagcccgcggacaactgtgactccagcctgagcaggacgtatgccatctcatcctctctc
atcagcttttacatccccgtggccatcatgatcgtcacctacaccaggatctacaggatc
gcccagaaacagatacggcgcatctcggccctggagagggcggccgtccacgccaagaac
tgccagaccacgacggggaacggaaaccccgcggagtgcgcgcagccggagagctccttt
aagatgtccttcaaaagggagaccaaggtcctgaagacgctgtcggtgatcatgggcgtg
tttgtgtgctgctggcttcccttcttcatcctgaactgcatggtgcccttctgcgggtcg
ggggagacccagcccttctgcattgattccatcaccttcgacgtgtttgtgtggtttggg
tgggctaattcctccttgaaccccatcatttatgccttcaatgctgatttccggaaggca
ttttcaaccctcttgggatgctacaggctctgcccgacgaccggtaacgccatagagacg
gtcagcatcaacaacaacggggccgtggtcttctccagccaccacgagccacgaggctcc
atctccaaggactgcaacctggtgtacctgatcccgcatgccgtgggctcctccgaggac
ccgaagaggcaggaggcagggggagtagccagaccctcggagaagctgtccccggccctc
tctgtcattttggactacgacaccgatgtctctctaggaaagatccagcccattacacag
aatggacagcaccccacctga

DBGET integrated database retrieval system