KEGG   Miniopterus natalensis: 107533931
Entry
107533931         CDS       T05883                                 

Gene name
CASP8
Definition
(RefSeq) caspase-8
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
mna  Miniopterus natalensis
Pathway
mna01524  Platinum drug resistance
mna04115  p53 signaling pathway
mna04210  Apoptosis
mna04215  Apoptosis - multiple species
mna04217  Necroptosis
mna04620  Toll-like receptor signaling pathway
mna04621  NOD-like receptor signaling pathway
mna04622  RIG-I-like receptor signaling pathway
mna04625  C-type lectin receptor signaling pathway
mna04657  IL-17 signaling pathway
mna04668  TNF signaling pathway
mna04932  Non-alcoholic fatty liver disease
mna05010  Alzheimer disease
mna05016  Huntington disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05132  Salmonella infection
mna05134  Legionellosis
mna05142  Chagas disease
mna05145  Toxoplasmosis
mna05152  Tuberculosis
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05162  Measles
mna05163  Human cytomegalovirus infection
mna05164  Influenza A
mna05165  Human papillomavirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
mna05203  Viral carcinogenesis
mna05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    107533931 (CASP8)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107533931 (CASP8)
   04215 Apoptosis - multiple species
    107533931 (CASP8)
   04217 Necroptosis
    107533931 (CASP8)
   04115 p53 signaling pathway
    107533931 (CASP8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107533931 (CASP8)
   04621 NOD-like receptor signaling pathway
    107533931 (CASP8)
   04622 RIG-I-like receptor signaling pathway
    107533931 (CASP8)
   04625 C-type lectin receptor signaling pathway
    107533931 (CASP8)
   04657 IL-17 signaling pathway
    107533931 (CASP8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107533931 (CASP8)
   05203 Viral carcinogenesis
    107533931 (CASP8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107533931 (CASP8)
   05016 Huntington disease
    107533931 (CASP8)
   05022 Pathways of neurodegeneration - multiple diseases
    107533931 (CASP8)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107533931 (CASP8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107533931 (CASP8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107533931 (CASP8)
   05134 Legionellosis
    107533931 (CASP8)
   05152 Tuberculosis
    107533931 (CASP8)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107533931 (CASP8)
   05161 Hepatitis B
    107533931 (CASP8)
   05160 Hepatitis C
    107533931 (CASP8)
   05164 Influenza A
    107533931 (CASP8)
   05162 Measles
    107533931 (CASP8)
   05168 Herpes simplex virus 1 infection
    107533931 (CASP8)
   05163 Human cytomegalovirus infection
    107533931 (CASP8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107533931 (CASP8)
   05169 Epstein-Barr virus infection
    107533931 (CASP8)
   05165 Human papillomavirus infection
    107533931 (CASP8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107533931 (CASP8)
   05142 Chagas disease
    107533931 (CASP8)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107533931 (CASP8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mna01002]
    107533931 (CASP8)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     107533931 (CASP8)
Peptidases and inhibitors [BR:mna01002]
 Cysteine peptidases
  Family C14: caspase family
   107533931 (CASP8)
SSDB
Motif
Pfam: Peptidase_C14 DED
Other DBs
NCBI-GeneID: 107533931
NCBI-ProteinID: XP_016064298
LinkDB
Position
Unknown
AA seq 510 aa
MSFSNCLYEIGEALSSEEVASLKFLCLDYIPQKKQESIKDALMLFQRLQEKRMLEECNLS
FLKELLFLINRLDLLEKYLNTSKEEMKRELQTSGRGQISTYRAMLLQISEEVIESEVKDF
KFFLSQEISRCKLDDSMSLLDIFIEMEKRLILGEKKLDTLTRICNKVNKSLLKKISDYEE
ELSREGRMSLCQRSPDEFSSDMSQLPAEGGPPEMLSMSDYPREQDLDQREQDFKPQEQDS
EPGEQDSHPQQTLDKVYRMKSKPRGYCVIFNNYDFSKARENIPKLQTMKDRNGTDLDAEA
LLSTFSQLHFETVHYKDSTAKEICEVLKNYQRMDHKKRDCFICCILSHGDEGIIYGSDGQ
EASIYELTSYFTGAKCPSLAGKPKIFFIQACQGNNYQGRIAVEADSREKEACLDMDSLCR
KRYIPDEADFLLGMATVKNYVSYRNPMEGSWYIQSLCQSLRERCPRGDDILTILTEVNFE
VSNKDDKKNMGKQMPQPTFTLRKKLFFPLH
NT seq 1533 nt   +upstreamnt  +downstreamnt
atgagtttcagcaattgtttatatgaaattggggaagctctgagcagtgaggaggtggcc
tcgctcaagtttctgtgcctggactacataccacaaaagaagcaggaatccatcaaggat
gccttaatgttgttccagagactccaggaaaaaagaatgttggaagaatgcaacttgtcc
ttcttgaaagagctgctattccttattaatagactggatctactggaaaagtacctgaac
accagcaaggaagagatgaaaagggagcttcagacatcaggcaggggtcagatctctaca
tacagggccatgcttctccagatttcagaagaagtaattgaatcggaagtgaaggacttt
aaattttttttgagccaggagatatccagatgtaaactggatgatagcatgagcttgctt
gatattttcatagagatggagaagaggctcatccttggggaaaaaaagttggacacccta
acgagaatctgtaacaaagtcaacaagagcctgctgaagaaaatcagcgattatgaagaa
gaattaagcagagagggaagaatgagcctttgtcaaagaagtccagatgaattttcaagt
gatatgtctcagttacctgcagagggagggccacctgagatgctgtcaatgtcagactat
ccaagagaacaggacttggatcaacgagaacaggacttcaagccacaagaacaggacagt
gagccaggggaacaggacagtcacccacagcagacattggacaaagtttatcgaatgaaa
agcaagcctcggggatactgtgtgatctttaacaattacgatttcagcaaagcacgggag
aacattcccaaacttcaaacaatgaaggacaggaacggaacagacttggatgcagaggct
ttgctcagcacctttagtcagcttcattttgagacggtgcattacaaagactctacagca
aaggaaatctgtgaggttctgaaaaactaccaaaggatggaccacaagaagagagactgc
ttcatctgttgcatcctttcccatggagatgaaggcatcatctacggctctgatgggcaa
gaagcctccatctatgagcttacctcttacttcactggtgcgaagtgcccttcccttgca
ggcaaacccaaaatcttttttatccaggcttgtcaagggaataactaccagggacgtata
gctgttgaggctgactcaagagagaaggaagcctgcttggatatggactcattatgtcgg
aagagatatatcccagatgaagctgactttctgctggggatggccacagtgaaaaactat
gtttcctaccgaaaccccatggaggggagctggtatatccaatcactgtgccagagcctg
agagaaagatgccctaggggtgatgatattctcactatcctcactgaggtgaactttgaa
gtgagcaataaggatgacaagaaaaacatggggaagcagatgccacaacctaccttcact
ctgagaaaaaaactcttcttccctcttcattga

DBGET integrated database retrieval system