KEGG   Miniopterus natalensis: 107533944
Entry
107533944         CDS       T05883                                 

Gene name
TRAK2
Definition
(RefSeq) trafficking kinesin-binding protein 2
  KO
K15374  trafficking kinesin-binding protein 2
Organism
mna  Miniopterus natalensis
Pathway
mna01100  Metabolic pathways
mna04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107533944 (TRAK2)
SSDB
Motif
Pfam: HAP1_N Milton
Other DBs
NCBI-GeneID: 107533944
NCBI-ProteinID: XP_016064324
LinkDB
Position
Unknown
AA seq 929 aa
MTVQAVLLNQSTKGSCMNQSQNAIFTSPAGEENLMNSNHRDSESITDVCSNEDLPEVELV
SLLEEQLPQYRLKVDSLFLYENQDWTRSPHQQHHASGALPPVVAEETFRYMILGTDRVEQ
MTRTYNDIDMVTHLLAERDRDLELAARIGQALLKRNHVLSEQNEALEEQLGQAFDQVNQL
QHELSKKDELLRIVSIASEESETDSSCSTPLRFNESFSLSQGLLQLDMLQEKLKELEEEN
MALRSKACHIKTETITYEEKEQQLVSDCVKELRETNAQMSKMTEELSGKSDELIRYQEEI
SSLLSQIVDLQHKLKEHVIEKEELRLHLQASKDAQRQLTLELHELQDRNMECLGMLHESQ
EEIKELRSRSGPAAHLYFSQSYGAFSGESLASEIEGTMRKKLSLDEESSLFKQKAQLKRV
FDTVRIANDTRGCSIPFSAPLSIPGSNRSSVIMTAKPFESGLQPTEDKTLLSQGSNSEEV
PGNIQKLGQQEPSGDSDLATALHRLSLRRQNYLSEKQFFAEEWERKIQVLADQKEGVSGC
GTPTESIVSLCTDQSETTDLSSASCLRCFMPEKLQIVKPLEGSQTLHHWQQLAQPNLGTI
LDPRPGVITKGFTQLPKDDVYHLSDLEEDEEEGITFQVQQPLQVEQKPTDPKPVTGIFLP
PGTSTGPVTVATSNPGKCLSCTNLTFTFTTCRILHPSDVTQVTPSSGFPSLSCGSSSSSS
SNTAVNSPAMSYRLSIGESVTNRRDSTVTFSSTMSLAKLLQERGISAKVYHSQVSENPLQ
PLPKVLATPSTPPNSPSHSPCPSPLPFEPRVHLSENFLASRPAETFLQEMYGLRPSRNPP
DVGQLKMNLVDRLKRLGIARVIKSPDAQKNGKSQEAEIGLRRPDSTVYLNSGSNLLSGLR
RNQSLPIMMGSFGTSGCTSSHKMDILQED
NT seq 2790 nt   +upstreamnt  +downstreamnt
atgactgtccaagctgtcctcctcaaccaaagcacgaaaggatcctgcatgaatcaatcc
cagaatgccatttttacatcaccagcaggtgaagaaaacctcatgaatagcaatcacaga
gactcagagagcatcactgatgtctgctccaatgaggatctccctgaggttgagctggtg
agtctgttagaagaacagctaccccagtatagactgaaagtggactcgctctttctatat
gaaaatcaagactggactcggtccccacaccagcagcatcatgcatctggtgccctccct
ccagtcgttgctgaagagactttccgttatatgattctaggcacagacagggtggagcag
atgaccagaacttacaatgacatcgacatggttacacatctcctggcagagagggatcgt
gatctggagctagctgctcgaattggacaagctctcttaaagcgaaatcatgtcttgtct
gagcagaatgaagccctggaggaacaattgggacaagcttttgaccaagttaatcaactg
cagcatgagctatccaagaaagatgagttacttcggattgtgtccattgcttctgaagag
agtgaaactgattccagctgttctacacctcttcggttcaatgagtccttcagcttatct
caaggcttgctacagttggacatgctgcaagaaaagctcaaggaactggaagaagagaat
atggctctccgatccaaggcttgtcacataaagacagaaactattacttatgaagagaag
gaacaacagcttgtcagtgactgtgttaaagaacttcgtgaaacaaatgctcagatgtcc
aaaatgactgaggaattgtctgggaagagtgatgaactgattcgataccaagaagagatc
tcctctctcttgtctcagattgtagatcttcagcacaaacttaaagaacatgtgattgaa
aaggaagaactgagacttcacctacaagcttccaaagatgcccagagacaactgacattg
gagctgcatgagttacaagacaggaatatggagtgtctgggaatgttacatgaatcccaa
gaagaaataaaggaacttcgtagtagatctggccctgctgctcatctctacttctcccaa
tcatatggagctttttctggggaatctctggcatctgagattgaggggaccatgcgtaaa
aagttgagtttggatgaggaatcttctctctttaaacaaaaagcccagctgaaacgggta
tttgatactgtcaggattgccaatgacacacggggctgctctatcccattctcagctccg
ctatccattccaggctccaaccgctcaagtgtcatcatgacagcaaaaccttttgagtct
ggtttacagccaacagaggacaaaacactcctgagccaggggagcaactcagaggaggtt
ccagggaacattcagaagctgggtcaacaagaaccctctggagatagtgatttggctaca
gccctgcatcgccttagtctgcggcgacaaaactacttaagtgagaagcagttctttgct
gaagagtgggagcggaagatccaggttctggctgaccagaaagaaggggttagtggctgt
ggcaccccaacagagagtattgtctctctctgcactgaccagtcggagaccacagacctc
agcagtgccagttgtcttcgatgttttatgcctgaaaaattacaaattgtcaagccactt
gaaggatcacaaactctgcaccactggcagcagcttgctcaaccaaatttaggaaccatt
cttgacccacgaccaggtgtcatcactaaaggctttacccagttgcccaaggatgacgtc
tatcacctctcggatttagaagaggatgaagaggaaggtatcacttttcaggttcagcag
cctcttcaagtggaacagaaacctacagatcccaagccagtaacaggaatctttctgccc
cccggtacatcaacaggtccagttacagttgcaacctcaaacccaggaaagtgtctgtca
tgcacaaacttgacattcaccttcaccacctgtaggatattacatccctctgatgtcact
caggttacccccagctctgggttcccttcattatcctgtgggagcagcagtagcagttcg
tcaaacacggcagtgaattctcctgctatgtcctatagactcagcattggtgaatcagtc
accaaccgacgggattccaccgtaaccttcagcagcaccatgagcttggccaaacttcta
caggagcgaggcatttctgctaaagtgtaccacagccaagtttcagagaacccccttcag
cctctccctaaagtcctggctaccccttccacacccccaaattcaccatctcactcacct
tgcccttctcctttgccctttgagcctcgagtacatctctctgaaaattttttggcctcc
cgaccggctgaaacattcctacaggagatgtatggcttgagaccttcccggaaccctcct
gatgttggccagttgaagatgaacttagtagacaggctgaagagactggggatagccaga
gtgattaagagccctgatgcccagaaaaatggaaaaagccaagaggcagaaattggtctt
cgaagaccagactctactgtttatttaaattcaggtagcaatttattaagtggattgagg
aggaatcagagtctcccgatcatgatgggtagttttggcacctcaggttgcacatcctca
cacaaaatggatatcctgcaggaggactga

DBGET integrated database retrieval system