KEGG   Miniopterus natalensis: 107534101
Entry
107534101         CDS       T05883                                 

Gene name
GSR
Definition
(RefSeq) glutathione reductase, mitochondrial
  KO
K00383  glutathione reductase (NADPH) [EC:1.8.1.7]
Organism
mna  Miniopterus natalensis
Pathway
mna00480  Glutathione metabolism
mna01100  Metabolic pathways
mna04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107534101 (GSR)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    107534101 (GSR)
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.7  glutathione-disulfide reductase
     107534101 (GSR)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 K_oxygenase FAD_binding_2
Other DBs
NCBI-GeneID: 107534101
NCBI-ProteinID: XP_016064564
LinkDB
Position
Unknown
AA seq 410 aa
MWNTAVHSEFMHDHVDYGFQSCDGKFNWRVIKEKRDAYVSRLNTIYQNNLTKAHIEFIPG
YAAFTGDPTPTVEVNGKKYTAPHILIATGGVPSHPQESEIPGAHLGITSDGFFQLEELPS
RSVIVGAGYIAVEIAGILSALGSKTLLMIRHDKVLRTFDSMISSNCTEELENAGIEVLKY
SQVKEVKKTPSGLELSVVSSVPGWKPTLTTIPDVDCLLWAIGRDPNSSGLNLDKLGIQTD
YKGHIIVDEFQNTNVKGIYAVGDVCGKALLTPVAIAAGRKLAHRLFECKKDSKLDYDNIP
TVVFSHPPIGTVGLTEDEAISKYGKENVKTYSTTFTPMYHAVTKRKTKCVMKMVCANKEE
KVVGIHMQGIGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTMR
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgtggaacacggccgtccactctgaattcatgcacgatcacgttgattacggctttcag
agttgtgatggtaaattcaattggcgggttataaaggaaaagcgggatgcctatgtgagc
cgcctgaacaccatctatcaaaataatctaaccaaggcccacatagaattcatccctggc
tatgcagcattcacgggtgaccccacgcccacggtagaggtcaatggcaaaaagtacact
gctcctcacatcctgattgcaacaggtggcgtcccctcgcatcctcaggagagcgagatc
cccggtgcccacctaggaataaccagtgatggattttttcaactggaagaattgcctagc
cgcagtgtcattgttggagcaggatacattgctgtggagatagcagggatcctttctgcc
ctaggttctaagacattactcatgatacggcatgataaggtacttagaacttttgattca
atgatcagttccaactgcactgaagagctggagaatgctggcatagaggtcctgaagtac
tcgcaggtcaaggaagttaaaaagactccctcgggcttggaactctccgtggtttcttca
gttcctggttggaaacccaccttaaccacgattccagatgttgactgcctgctctgggcc
attgggcgggacccaaattccagcggcctgaatttagacaaactgggaattcaaactgat
tacaaaggtcacatcatcgtagatgaattccagaatactaacgtgaaaggcatctacgca
gttggggatgtgtgtggaaaggctcttcttactccagttgccattgctgctggccgaaaa
cttgcccatagactttttgaatgcaaaaaagattccaaattagactatgacaacatcccc
acggtggtcttcagccacccccctattggcacagtgggactcacagaagatgaggccatt
tctaaatacggaaaggaaaatgtgaagacctattcaaccaccttcaccccaatgtatcat
gcagttaccaaaaggaaaacaaaatgtgtgatgaaaatggtttgtgctaacaaagaggaa
aaggtggtcgggatccatatgcaaggaattgggtgtgatgaaatgctgcagggttttgct
gttgcagtcaaaatgggagccacaaaagccgactttgacaacacagttgccattcaccct
acctcttcggaagaactggtcacaatgcgttga

DBGET integrated database retrieval system