KEGG   Miniopterus natalensis: 107534157
Entry
107534157         CDS       T05883                                 

Gene name
LIPE
Definition
(RefSeq) hormone-sensitive lipase
  KO
K07188  hormone-sensitive lipase [EC:3.1.1.79]
Organism
mna  Miniopterus natalensis
Pathway
mna04024  cAMP signaling pathway
mna04152  AMPK signaling pathway
mna04371  Apelin signaling pathway
mna04714  Thermogenesis
mna04910  Insulin signaling pathway
mna04923  Regulation of lipolysis in adipocytes
mna04925  Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107534157 (LIPE)
   04024 cAMP signaling pathway
    107534157 (LIPE)
   04152 AMPK signaling pathway
    107534157 (LIPE)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107534157 (LIPE)
   04923 Regulation of lipolysis in adipocytes
    107534157 (LIPE)
   04925 Aldosterone synthesis and secretion
    107534157 (LIPE)
  09159 Environmental adaptation
   04714 Thermogenesis
    107534157 (LIPE)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.79  hormone-sensitive lipase
     107534157 (LIPE)
SSDB
Motif
Pfam: HSL_N Abhydrolase_3 Say1_Mug180
Other DBs
NCBI-GeneID: 107534157
NCBI-ProteinID: XP_016064636
LinkDB
Position
Unknown
AA seq 802 aa
MESAEEAGPAEAPGAPASKEDKERSLSKSRRRRRWRKTKAKASQLIQSMDLRTMTQTLVT
LAEDNMAFFSSQGPGETARRLSNVFMGVREQALGLEPALGRLLGVAHLFDLDAETPANGY
RSLVHTARCCMAHLLHKSRYVASNRRSIFFRASHNLAELEAYLAALTQLRALTYYAQRLL
ATNRPGGLFFEGDERLTTDFLREYVTLHKGCFYGRCLGFQFTPAIRPFLQTISIGLVSFG
EHYKRNETGLSVAASSLFTGGRFAIDPELRGAEFERITQNLDVHFWKAFWNITEIEVLSS
LANMASATVRVSRLLSLPPEAFEMPLTADPKLTVTISPPSAHLGPAPVLVRLISYDLREG
QDSEELNSLGKSEGPRSLELWPRPPQAPRSRYLVVHIHGGGFVAQTSKSHEPYLKTWAQE
LGVPILSIDYSLAPEAPFPRALEECFYAYCWAIKNCALLGSTCERICLAGDSAGGNLCFT
VSLRAAAYGVRVPDGIMAAYPATMLQPAASPSRLLSLMDPLLPLSVLSKCVSAYAGGETE
DHSNSDQKALGMMGLVRRDTALLFRDLRLGASSWLNSFLELSGRRSHSNSMPVAETMRRS
VSEAALAQPEDPLGTDPLRKLTLHDLSLRGSSDTSGTPELSLSAETLGPSTPSDVNFLLR
PEAEPEEVEAQDELSSQNRGPGIGASFPEGFHPRRSSQGPTQMPLYSSPIAKNPFMSPLL
APESMLQSLPPVHIVACALDPMLDDSVMFARRLRSLGKPVTLSVVEDLPHGFLSLASLCR
ETRQVLTPPATTASATTKPARV
NT seq 2409 nt   +upstreamnt  +downstreamnt
atggagtcagccgaggaagcggggcccgccgaggcccctggggccccagcctcgaaggag
gacaaagagagatctttatccaagagccgtaggcgccggcgatggcgaaaaaccaaggcc
aaagcctcgcagctcattcaaagcatggacttacgcacaatgacacagacactggtgact
ctggcagaggacaatatggccttcttctccagccagggccccggggagacagcacggcgg
ctgtcaaatgtctttatgggtgttcgggagcaggcgctggggctggagccagccctgggc
cgcctgctgggtgtggcgcacctctttgacctggatgcagagacgccagccaacgggtac
cgcagcctggtgcacacagcccgctgttgcatggcgcacctgctgcacaaatcgcgctac
gtggcctccaaccgccgcagcatcttcttccgtgcgagccacaacctggctgaactcgag
gcctacctggccgccctcacccagctccgagctctgacctactatgcccagcgcctgctg
gccaccaaccggccagggggcctcttcttcgaaggtgacgaaagactcaccacagacttc
ctgcgagagtatgtcactctgcacaagggctgtttctacggccgctgcctgggctttcag
ttcacacctgccatcaggccattcctgcagaccatctccatcgggctggtgtcctttgga
gagcactacaaacgcaacgaaaccggcctcagtgtggccgccagctccctctttactggt
ggccgctttgccatcgacccagagctgcgtggggctgagtttgagcggatcactcagaac
ctggacgtgcacttctggaaagccttttggaacatcactgagatcgaggtgctatcgtct
ctagcaaacatggcatcggccaccgtgagggtaagccgcctgctcagcctgccaccagag
gcctttgaaatgccactgactgctgaccccaaactcacagtcaccatctcacccccctcg
gcccacttgggccctgcaccagtcctcgtcaggctcatctcctatgatcttcgtgaagga
caggacagtgaggagctcaacagcctggggaagtccgaaggtcctcggagcctggagctt
tggccacgccccccgcaggcaccccgctctcggtacctggttgtgcacatccatggtggt
ggctttgtggcccagacctccaagtcccatgagccctacctcaagacctgggcccaggag
ctgggtgtccccatcctctccattgactactccctggccccagaggcccccttcccccga
gcgctggaggagtgcttctatgcctactgctgggccatcaagaactgcgccctcctcggc
tcaacatgcgagcggatatgcctcgcaggggacagcgcaggcgggaacctctgcttcacc
gtctccctgcgggcagcagcctacggggtgcgggtgccagacggcatcatggcagcctat
ccagccaccatgctacagcccgcggcctctccctcccgccttctgagcctcatggacccc
ctgctgcccctgagcgtgctttccaagtgtgtcagtgcctatgctggtggggagacagag
gaccactccaactcggaccagaaggcactaggcatgatggggctggttcggcgggacaca
gccctgctcttccgggatctccgcctgggggcctcctcgtggctcaactccttcctggag
ctgagtgggcgcaggtcccactcgaactcaatgcctgtggcagagacaatgcggcgcagt
gtgtctgaagcagcactggcccagcctgaggacccgttgggcacagaccccctcaggaaa
ctgacactgcatgacctgagcctcaggggcagctcggatacatcaggcacccctgagctg
tcactgtcagcagagacacttggtccctccacgccctcggatgtcaacttcttacttcgg
cctgaggctgaaccagaagaggttgaagcccaagatgagctgagctcccagaacagaggc
ccaggcattggtgcctctttccctgagggcttccacccgaggcgctccagccaaggccct
acacaaatgcccttatactcgtcgcccatcgccaagaaccccttcatgtcaccactgctg
gcacctgagagcatgctgcagagcctgccacctgtgcacatcgtggcatgcgcgctggac
cccatgttggacgactcggtcatgttcgcgcggcggctgcgcagcctgggcaagcccgtg
acgctgagcgtggtggaggacctgccgcacggcttcctgagcctggcgtcgctgtgccgg
gagacgcggcaggtcctcactccacccgccaccaccgcgtctgccaccaccaagcccgcg
cgggtctga

DBGET integrated database retrieval system