KEGG   Miniopterus natalensis: 107534337
Entry
107534337         CDS       T05883                                 

Gene name
ANO8
Definition
(RefSeq) anoctamin-8 isoform X1
  KO
K19502  anoctamin-8
Organism
mna  Miniopterus natalensis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107534337 (ANO8)
Ion channels [BR:mna04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   107534337 (ANO8)
SSDB
Motif
Pfam: Anoctamin Voltage_CLC MCM_bind
Other DBs
NCBI-GeneID: 107534337
NCBI-ProteinID: XP_016064897
LinkDB
Position
Unknown
AA seq 1240 aa
MAEATSGAGGTSLEGERGKRPPPEGEPAAPASGVLDKLFGKRLLQAGRYLVSHKAWMKTV
PTENCDVLMTFPDTTDDHTLLWLLNHIRVGIPELIVQVRHHRHTRAYAFFVTATYESLLR
GADELGLRKAVKAEFGGGTRGFSCEEDFIYENVESELRFFTSQERQSIIRFWLQNLRAKQ
GEALHNVRFLEDQPIIPELAARGIIQQVFPVHEQRILNRLMKSWVQAVCENQPLDEICDY
FGVKIAMYFAWLGFYTSAMVYPAVFGSVLYTFTEADQTSQDVSCVVFALFNVVWSTLFLE
EWKRRGAELAYKWGTLDSPGETVEEPRPQFRGVRRISPVTRAEEFYYPPWKRLFFQLFVS
VPLCLTCLACVFLLMLGCFQLQDLVLSVKGLPRLARFLPKVVLALLVSISAEGYKKLAIW
LNDMENYRLESAYEKHLIIKVVLFQFINSYLSLFYIGFYLKDMERLKEMLATLLITRQFL
QNVREVLQPHLYRRLGRGELSLRAAWELAQALLGLLSLRRPAPCHLEPQAEEAGGSGGGG
GRRCLSGGCGAPEEEEEATVERRPTGEGGEVRNGLRGAKEEEEDDEDEEEEEEDEDEGEE
GGLLDCGLRLKKVSFAERGVGRHQPGPSPEALLEEGSPTMVEKGLEPGVFTLAEEDDEVE
GAPGSPEREPPAVLLRRAGGEGHDQGPDGGPELEAGSGNLARKQRRQNRSSWIDPPEEEH
SPQLTQAELESCMKKYEDTFQDYQEMFVQFGYVVLFSSAFPLAALCALVNNLIEIRSDAL
KLCTGLQRPFGQRVESIGQWQKVMEAMGVLAIIVNCYLIGQCGQLQRLFPWLSPEAAIVS
VVVLEHFALLLKYLIHVAIPDIPGWVAEEMAKLEYQRREAFKRHERQAQHRYQQQQRRRR
EEEERQRHAEHHARRERDTSGREETRAEGSGSDPAAPEKASAKAKGSGVSGHGSERPKRP
GSLLAPNNVMKLKQIIPLQGKFLSSGATSSIAGTGPGPTTRPTPAQSPTGSDTRLPAFLS
FKFLKSPETRREPERSHSPPKAFHASKLFPFGSGARAEAGANGVGGQVRLDGTPGGSSGG
GSGGGGGGGGGSGWAQRSGPADEAAAEEPDVLRPEEEGSGTALAPVSTPALRTRSSRSPV
PSTPTPLPRPPTPPASCWQWDGPWGCGGEGAAPRQAPATNAECPPCALAGPPPAPQPLPG
DTSFYSLAPLPLPPSSEPPESPSASPSPSPQAACWPSGWH
NT seq 3723 nt   +upstreamnt  +downstreamnt
atggccgaagctacctctggagctgggggcacgtccctggagggcgagcggggcaagagg
cccccgccagagggcgagcctgcagccccggcgtccggagttctggataagctttttggg
aagcggctcttgcaagcgggtcgatacctggtgtcccacaaggcttggatgaagactgtg
cccacggagaactgcgacgtactgatgaccttcccagatacaacggatgaccacacgctg
ctatggctgctgaaccacatccgtgtgggcatccctgagctcatagtgcaagtccgccac
caccgccacacgcgtgcctatgccttcttcgtcaccgccacatatgagagcctactccga
ggggccgacgagctgggtctgcgtaaagcagtgaaggctgagtttggagggggtacccgc
ggcttctcctgcgaggaggactttatctatgagaacgtggagagtgagctacgcttcttc
acctcccaggagcgccagagcatcatcagattctggcttcagaacctgcgagccaagcag
ggtgaggcactgcacaatgtacgtttcctggaggaccagccaatcatccctgagctggcg
gcccgtgggatcatccagcaagtgttcccggtccatgagcaacgcatcctgaaccgcctt
atgaagtcatgggtgcaggctgtgtgtgaaaaccagcccctagatgagatctgcgactat
tttggtgtgaagattgccatgtactttgcctggctgggcttctatacgtcggcgatggta
tatccagctgtctttggctctgtcctgtacacattcacagaagccgatcagacaagccag
gatgtatcctgtgtggtctttgccctgttcaacgttgtctggtcaacactattcttggaa
gagtggaaacggaggggggcagagctggcctacaagtgggggacactggattcaccaggg
gaaaccgtggaggagccacgaccccagttcaggggtgtgcgacgcatcagcccagtgaca
cgggccgaggagttctactatccaccctggaagcggctgttctttcagctgtttgtgagt
gttcccttatgcctcacctgcctggcctgcgtgttcctgctcatgctcggctgtttccag
ttgcaggatctggtgctgagtgtgaaggggctgccccgccttgccaggttcctgcccaag
gtcgtgctggccctgctggtcagcataagtgcagagggctacaagaaacttgccatatgg
ctcaatgacatggagaattatcggctggagagcgcctacgagaagcacctcattattaag
gttgttctgttccagttcatcaattcctacctgagcctcttctacattggcttctacctc
aaggacatggagcgcttgaaagagatgctggccactttgctgatcacccgccagtttctt
cagaatgttcgcgaggtcctacagccacacctataccggcggctgggccgaggcgagctc
agcctgcgggccgcttgggagctggcccaggccctccttggcctgctcagccttcggcgc
cctgcaccctgccaccttgaaccccaggccgaagaggctggtggcagtggtggcggaggg
ggccgcaggtgtctcagcgggggctgcggggcacccgaggaggaggaagaggccacagtg
gaacggcggcccacaggggaaggtggggaggtgaggaacgggttgaggggggccaaggag
gaggaggaggacgacgaggacgaggaggaagaggaggaggacgaggacgagggtgaggag
ggcggcctcctggactgcgggctccggctaaagaaggtcagctttgctgagcggggggtt
gggcggcatcagcctggcccaagtccggaagccctcctggaggaggggagccccacgatg
gtggagaaggggctggagccgggcgtgttcacactagccgaggaggatgatgaggtggag
ggggctcctggcagccctgagcgggagcccccagctgtcctgctccgccgggctgggggc
gagggccatgaccaggggccagatgggggcccagagctggaggctggctcaggcaacttg
gcccggaagcagcggcggcagaatcggtcctcttggatcgacccgcccgaggaggagcac
tcaccccagctcacccaggctgagcttgagagctgtatgaagaagtatgaggacacgttc
caggactaccaggagatgttcgtgcagtttggctacgtcgtgctcttctcgtctgccttc
cccctggctgcgctgtgcgccctggtcaacaacctcattgagatccgcagtgatgccctc
aagctgtgcacggggctgcagcggccctttgggcagcgggtcgagagcatcggccagtgg
cagaaggtgatggaggccatgggtgtcctggcaatcattgtcaactgctatctcattggc
cagtgcgggcagctgcagcgcctcttcccctggctcagtcccgaggcggccattgtgtcc
gtggtagtgcttgagcacttcgctctgcttctcaagtacctcatccatgtggccatccct
gacatcccagggtgggtggccgaggagatggccaagctcgagtaccagcgccgggaggcc
ttcaagagacacgagcgccaggcccaacaccgttaccagcagcagcagcggaggcgacgg
gaggaggaggagcgccagcgccatgcagagcaccatgcccggcgggagcgtgacaccagc
ggccgtgaggagacccgggccgagggctccgggtcggaccccgctgcccctgagaaggcc
tcagccaaggccaagggcagtggggtgagtggccacggttctgagcggcccaagcgccca
gggtccctgctggcgcccaacaatgtcatgaagctcaagcagatcatcccgctgcagggc
aagtttttgtcgtcaggggccacgtcctcaatagcaggcactgggcccggccccaccacg
cggccaacccctgctcagtcacccacaggcagcgatacccgcctgcccgccttcctcagc
ttcaagttcctcaagtcacctgagacccggcgggagcccgagcgcagccactcgccaccc
aaggccttccatgccagcaagctcttcccctttggcagtggggcccgggctgaggccggg
gccaatggggtgggcgggcaggtccggctggatgggacccctggtggtagcagtggtggt
ggcagtggcggtggcggtggcggtggcggtggcagcggctgggcccagcgcagtgggcct
gcggacgaggctgcggctgaggagccagatgtcctccggccagaagaagaaggctcaggg
acagcactggccccagtgagcaccccagcccttcgcacccgcagcagccgaagccccgtg
ccatcaacgccaacgcctctgcccaggcccccaacaccgcccgccagctgttggcagtgg
gatgggccttggggctgtggaggcgaaggtgctgccccccgccaggcccctgccaccaat
gcagagtgcccgccatgtgccctggctgggcccccgccagccccccagcccctgccaggt
gacaccagcttctacagccttgcgcctctgcctctgccaccatcctctgagccccctgag
tccccttcagcctctcccagccccagcccccaggctgcatgctggccaagtggctggcat
tag

DBGET integrated database retrieval system