KEGG   Miniopterus natalensis: 107534422
Entry
107534422         CDS       T05883                                 

Gene name
PRKD1
Definition
(RefSeq) serine/threonine-protein kinase D1 isoform X1
  KO
K06070  protein kinase D [EC:2.7.11.13]
Organism
mna  Miniopterus natalensis
Pathway
mna04015  Rap1 signaling pathway
mna04925  Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107534422 (PRKD1)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    107534422 (PRKD1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107534422 (PRKD1)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     107534422 (PRKD1)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: CAMK group
  PKD family
   107534422 (PRKD1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 PH Kinase-like C1_2 Kdo zf-RING_9
Other DBs
NCBI-GeneID: 107534422
NCBI-ProteinID: XP_016064999
LinkDB
Position
Unknown
AA seq 836 aa
MEREFPECGFYGMYDKILLFRHDPTSENILQLVKTAGDIQEGDLIEVVLSASATFEDFQI
RPHALFVHSYRAPAFCDHCGEMLWGLVRQGLKCEGCGLNYHKRCAFKIPNNCSGVRRRRL
SNVSLTGLTTVRTASAELSTSVPDEPLLSPLSPGFEQKSPSESFIGREKRSNSQSYIGRP
IQLDKILMSKVKVPHTFVIHSYTRPTVCQYCKKLLKGLFRQGLQCKDCRFNCHKRCAPKV
PNNCLGEVTINGDLLSPGAESDVVMEEGSDDNDSERNSGLMDDMEEAMVQDAAMVMAECQ
PDSGEMQDPDGDQEDSNRTISPSTSNNIPLMRVVQSVKHTKRKSSTVMKEGWMVHYTSKD
TLRKRHYWRLDSKCITLFQNDTGSRYYKEIPLSEILSLEPAKPSALISNGANPHCFEITT
ANVVYYVGENVVNPSSPPPSGSVLTSGVGADVARMWEVAIQHALMPVIPKGSSVGSGTNS
HRDISLSISVSNCQIQENVDISTVYQIFPDEVLGSGQFGIVYGGKHRKTGRDVAIKIIDK
LRFPTKQESQLRNEVAILQNLHHPGVVNLECMFETPERVFVVMEKLHGDMLEMILSSEKG
RLPEHITKFLITQILVALRHLHFKNIVHCDLKPENVLLASADPFPQVKLCDFGFARIIGE
KSFRRSVVGTPAYLAPEVLRNKGYNRSLDMWSVGVIIYVSLSGTFPFNEDEDIHDQIQNA
AFMYPPNPWKEISPEAIDLINNLLQVKMRKRYSVDKTLSHPWLQDYQTWLDLRELERKTG
ERYITHESDDLRWEQYAGEQGLRYPTHLIDPSAGHGDSPETEEREMKALSERVSIL
NT seq 2511 nt   +upstreamnt  +downstreamnt
atggagagagaattccctgaatgtggtttctatggaatgtatgataagatcctgctcttt
cgccacgaccctacctctgaaaacatccttcagctggtgaaaacggctggcgatatccag
gaaggcgatcttattgaagtggtcttgtcagcttctgctacctttgaagactttcagatt
cgtccccacgctctctttgttcattcgtacagagccccagctttctgtgaccactgtgga
gaaatgctgtgggggctcgtccgtcaaggccttaaatgcgaaggatgtggcctgaattac
cataaaagatgtgcatttaaaatccccaacaactgcagcggcgtgaggcggagaaggctc
tcgaacgtttcgctcacagggctcaccacagtgcgcacagcgtcggcagagctgtccacc
agtgtccccgacgagccccttctgtctcctctgagtcctggctttgagcaaaagtcaccg
tcagagtcatttattgggcgagagaagaggtcgaattctcagtcgtacatcggacgcccc
atccagcttgacaagattttgatgtcaaaagtgaaagtgcctcacacgttcgtcatccac
tcgtacacgcggcccaccgtgtgccagtactgcaagaagctcctcaaggggcttttcagg
cagggcctgcaatgcaaagattgcagattcaactgtcacaaacgttgcgcaccaaaagta
cccaacaactgcctgggcgaagtgaccatcaacggagatttgcttagccccggcgcagag
tctgacgtggtcatggaagaagggagtgacgacaatgacagcgaaaggaacagtgggctc
atggatgacatggaagaggcgatggtccaggatgctgcgatggtgatggcagagtgccag
cccgacagtggggagatgcaggacccagacggcgaccaggaggactccaacagaaccatc
agtccctcaacaagcaacaacatcccgctgatgagagtcgtgcagtctgtcaaacacacg
aagaggaaaagcagcaccgtgatgaaggaggggtggatggtccactacaccagcaaggac
accctgcggaaacggcactattggagattggatagcaaatgcattaccctctttcagaat
gacacgggaagcaggtactacaaggaaattcctttatcagaaattttatctctggaacca
gcaaaaccttcagccttaatttcgaatggggccaaccctcactgttttgagattactacg
gcaaacgtagtgtattacgtgggagaaaatgtggtcaatccttccagcccaccacccagt
ggcagtgtcctcaccagtggcgttggtgcagatgtggccaggatgtgggaggtggcgatc
cagcatgctctcatgcctgtcattcccaagggctcatccgtagggtcaggaaccaactct
cacagagatatttctctgagtatttcggtatcaaattgccagattcaagaaaatgtggac
atcagcacagtatatcagatttttcctgacgaagtactgggttctgggcagtttggaatt
gtttatggaggaaaacatcgtaaaacaggaagagatgtagctattaagatcattgacaaa
ttaaggtttccaacaaaacaagaaagccagcttcggaatgaggttgcaattctgcagaac
ctgcatcatcctggtgttgtgaatttggagtgtatgtttgagacgcctgaaagagtgttt
gttgttatggagaaactccatggagacatgctggagatgatcttgtcaagtgaaaagggc
aggttgccagagcacataacgaagtttttaattactcagatcctcgtggctttgcggcat
cttcactttaaaaatatcgttcactgtgacctcaaaccagaaaacgtgttgctcgcctcg
gccgatcccttccctcaggtgaagctgtgtgatttcggttttgcccgcatcatcggcgag
aagtctttccggaggtcggtggtgggcaccccggcctacctggctcccgaggtcctcagg
aacaagggctacaaccgctccctggacatgtggtcggtcggggtcatcatctacgtcagc
ctcagcggcaccttcccgttcaatgaggacgaagacattcacgaccagatccagaacgcc
gcgttcatgtaccctcccaacccctggaaggaaatctctcccgaagccatcgatcttatc
aataacttgctgcaagtaaaaatgagaaagcgctatagtgtggacaagaccttgagtcac
ccttggctacaggattatcagacctggttagatttacgagagctggaacgcaaaaccggg
gaacgctacatcacccacgaaagtgacgacttgaggtgggaacagtatgcaggcgagcag
ggcctgcgttaccccacacacctgatcgaccccagcgctggtcacggcgacagtcctgag
accgaagaaagagagatgaaagccctcagcgagcgtgtcagcatcctctga

KEGG   Miniopterus natalensis: 107536797
Entry
107536797         CDS       T05883                                 

Gene name
PRKD2
Definition
(RefSeq) serine/threonine-protein kinase D2
  KO
K06070  protein kinase D [EC:2.7.11.13]
Organism
mna  Miniopterus natalensis
Pathway
mna04015  Rap1 signaling pathway
mna04925  Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107536797 (PRKD2)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    107536797 (PRKD2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107536797 (PRKD2)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     107536797 (PRKD2)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: CAMK group
  PKD family
   107536797 (PRKD2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C1_2 Kinase-like Kdo zf-RING_9 ABC1 APH
Other DBs
NCBI-GeneID: 107536797
NCBI-ProteinID: XP_016068123
LinkDB
Position
Unknown
AA seq 878 aa
MAAAPSHPAGLPGSPGPGSPPPLGSLDLQSPPPLLPQVSVPAPGPGVSFHIQIGLTREFV
LLPAASELAHVKQLACSIVDQKFPECGFYGLYDKILLFKHDPTSANLLQLVRSAGDIQEG
DLVEVVLSASATFEDFQIRPHALTVHSYRAPAFCDHCGEMLFGLVRQGLKCDGCGLNYHK
RCAFSIPNNCSGARKRRLSSTSLASGHSVRLSTSDSLPCTADELSRSTTELLPRRPPSSS
SSASSYTGRPIELDKMLLSKVKVPHTFLIHSYTRPTVCQACKKLLKGLFRQGLQCKDCKF
NCHKRCATRVPNDCLGEALINGDVPMEEATDFSEADKSALIDESDDSGIIPGSHSENALH
ASEEEEAEGGKAQSSLGYIPLMRVVQSVRHTTRKSSSTLHEGWVVHYSNKDTLRKRHYWR
LDCKCITLFQNNTTNRYYKEIPLSEILTVEPAQNFSLVPPGTNPHCFEIVTANATYFVGE
TPGGAPGGPSGQAAEAARGWETAIRQALMPVILQDAPSAPGHAPHRQASLSISVSNSQIQ
ENVDIATVYQIFPDEVLGSGQFGVVYGGKHRKTGRDVAVKVIDKLRFPTKQESQLRNEVA
ILQSLRHPGIVNLECMFETPEKVFVVMEKLHGDMLEMILSSEKGRLPERLTKFLITQILV
ALRHLHFKNIVHCDLKPENVLLASADPFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLAP
EVLLNQGYNRSLDMWSVGVIMYVSLSGTFPFNEDEDINDQIQNAAFMYPACPWSRISAGA
IDLINNLLQVKMRKRYSVDKSLSHPWLQEYQTWLDLRELEGKMGERYITHESDDARWEQF
VAEHPLPGPGLPADRELDGAFPPQDHEMQGLAQRISVL
NT seq 2637 nt   +upstreamnt  +downstreamnt
atggcggccgccccctcccatcccgccgggctcccgggctcccccgggcccgggtctcct
ccgcccctcggcagcttggaccttcagtcgccgccaccgctgctgccccaggtttcggtc
ccggccccgggccctggggtctccttccacatccaaatcgggctgacccgcgagttcgtg
ctgttgcctgccgcctccgagctggcccatgtgaagcagctggcttgctccatcgtggat
cagaagttccccgagtgtggcttctatggcctttacgacaagatcctgctcttcaaacat
gaccccacgtccgctaacctcctgcagctggtgcgctccgccggagacatccaggaaggc
gacctggtggaggtggtgctgtccgcttcggccaccttcgaggacttccagatccgcccg
cacgcgctcaccgtgcactcctaccgagcgcccgccttctgcgaccactgcggggagatg
ctcttcggcctagtgcgccagggcctcaagtgtgatggctgtggactgaactaccacaag
cgctgtgccttcagcatccccaacaactgcagcggggcccgcaagcggcgcctgtcgtcc
acgtctctggccagtggccattcggtgcgcctcagtacctcggactccctgccctgcacg
gctgatgagctgagccgcagcaccaccgagctcctgcctcgccgccccccctcctcctcc
tcatctgcctcatcctacactggccgtcccatcgagctggacaagatgctgctctccaag
gtcaaggtgccacataccttcctcatccacagctacacgcggcccaccgtctgccaggct
tgcaagaaacttcttaaaggcctcttccgccagggcctacagtgcaaagactgcaagttt
aactgccacaaacgctgcgccacccgagtccctaatgactgtttgggagaggcacttatc
aacggagatgtgccgatggaggaggccaccgatttcagtgaggctgacaagagtgccctc
atagatgaatcagacgactccggtatcatcccaggctcccactcggaaaatgctctccac
gccagtgaggaggaagaagctgagggaggcaaggcccagagctccctagggtacatcccc
ctaatgagggtggtgcagtcagtgcgacacacgacacggaaatccagcagcacactgcac
gaaggttgggtggttcattacagcaacaaggacacgctgaggaagcggcactactggcgc
ctggactgcaagtgcatcacactcttccagaacaacacaaccaacagatactacaaggaa
atcccgctgtcagaaatcctcaccgtggagcccgcccagaacttcagccttgtgccacca
ggcaccaacccgcactgcttcgagattgtcactgccaatgccacctactttgtgggcgag
acgcctggtggggccccaggggggcccagcggacaagcggctgaggctgcccggggctgg
gaaacagccatccgccaggccctgatgcctgtcatcctccaggacgcgcccagtgcccca
ggccacgcgccccacagacaagcgtctctgagcatctcggtgtctaacagtcagatccaa
gagaatgtggacattgccactgtctaccagatcttcccggatgaggtgctgggctcaggg
caatttggagtggtctatggcggaaagcaccggaagacaggccgggatgtggcagtaaag
gtcatcgacaaactgcgtttccccaccaagcaggagagccagctccggaatgaagtggcc
attctgcagagtctgcggcacccggggatcgtgaacctggagtgcatgttcgagacgccc
gagaaggtgtttgtggtgatggagaagctgcacggggacatgctggagatgatcctctcc
agcgagaagggccggctgcccgagcgcctcaccaagttcctcatcacccagatcctggtg
gctttgagacacctgcacttcaagaacatcgtccactgtgacttgaaaccagaaaatgtg
ttgctggcatcagccgacccgtttccccaggtgaagctgtgtgacttcggtttcgctcgc
atcatcggtgagaagtccttccggcgctccgtggtgggcacgcccgcctacctggcgccc
gaggtgctgctcaaccagggctacaaccgctcgctggacatgtggtcagtgggcgtgatc
atgtacgtcagcctcagtggaaccttccccttcaacgaagacgaggacatcaacgaccag
atccagaacgccgccttcatgtaccccgcctgtccctggagccgcatctcagcgggagcc
atagacctcatcaacaacctgctgcaggtgaagatgcgcaagcgctacagcgtggacaag
tctctcagccacccgtggttacaggagtaccagacctggctggacctccgagaactggag
gggaagatgggcgagcggtacatcactcacgagagcgacgacgcgcgctgggagcagttc
gtggcggagcacccgctgcccgggcccgggctgcccgccgaccgggagctggatggggcc
ttcccaccgcaggaccatgaaatgcaggggctggcccagcgcatcagcgtcctctga

KEGG   Miniopterus natalensis: 107541787
Entry
107541787         CDS       T05883                                 

Gene name
PRKD3
Definition
(RefSeq) serine/threonine-protein kinase D3
  KO
K06070  protein kinase D [EC:2.7.11.13]
Organism
mna  Miniopterus natalensis
Pathway
mna04015  Rap1 signaling pathway
mna04925  Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107541787 (PRKD3)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    107541787 (PRKD3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107541787 (PRKD3)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     107541787 (PRKD3)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: CAMK group
  PKD family
   107541787 (PRKD3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 PH C1_2 Kdo Kinase-like zf-RING_9 RIO1 Pox_ser-thr_kin
Other DBs
NCBI-GeneID: 107541787
NCBI-ProteinID: XP_016074433
LinkDB
Position
Unknown
AA seq 890 aa
MSANNSPPSAQKSVLPATLPAVLPTPSSCSSPKTGLSARLSNGSFSTPSLTNSRGSVHTI
SFLLQIGLTRESVTIEAQELSLSAVKDLVCSIVYQKFPECGFFGMYDKILLFRHDMNSEN
ILQLITSADEIHEGDLVEVVLSALATVEDFQIRPHTLYVHSYKAPTFCDYCGEMLWGLVR
QGLKCEGCGLNYHKRCAFKIPNNCSGVRKRRLSNVSLPGPGLSVPRPLQTEYVALPTEES
HVHQEPSKRIPSWSGRPIWMEKMVMCRVKVPHTFAVHSYTRPTICQYCKRLLKGLFRQGM
QCKDCKFNCHKRCASKVPRDCLGEVTFNGEPSSLGTDTDIPMDIDSSDMNSDGSRGLDDT
EEPSPPEDKMFFLDPSDLDVERDEEAVKTISPSTSNNIPLMRVVQSIKHTKRKSSTVVKE
GWMVHHTSRDTLRKRHYWRLDSKCLTLFQNESGSKYYKEIPLSEILRISSPQDFTNISQG
SNPHCFEIITDTMVYFVGENNGDSSHNPVLAATGVGLDVAQSWEKAIRQALMPVTPQASV
CTSPGQGKDHKDLSTSISVSNCQIQENVDISTVYQIFADEVLGSGQFGIVYGGKHRKTGR
DVAIKVIDKLRFPTKQESQLRNEVAILQNLHHPGIVNLECMFETPERVFVVMEKLHGDML
EMILSSEKSRLPERITKFMVTQILVALRNLHFKNIVHCDLKPENVLLASAEPFPQVKLCD
FGFARIIGEKSFRRSVVGTPAYLAPEVLRSKGYNRSLDMWSVGVIVYVSLSGTFPFNEDE
DINDQIQNAAFMYPPNPWKEISGEAIDLINNLLQVKMRKRYSVDKSLSHPWLQDYQTWLD
LREFETRIGERYITHESDDARWEIHAYTHNLVYPKHFIMAPNPDDMEEDP
NT seq 2673 nt   +upstreamnt  +downstreamnt
atgtctgcaaacaattcccctccatcagcccagaagtctgtgttacctgcaactcttcct
gctgtgcttccaactccatcttcatgttcaagtccgaagacaggcctgtctgcccgactc
tctaatggaagcttcagtacaccatcactcactaactccagaggctcagtgcatacaatt
tcatttctactgcaaattggccttacacgggagagtgttaccattgaagctcaggaacta
tctttatctgctgtcaaggatcttgtgtgctccattgtttatcaaaagtttccagagtgt
ggattctttggcatgtatgacaaaattcttctctttcgccatgacatgaactcagaaaat
attttgcagctgattacctcagcagatgaaatacatgaaggagacctagtagaagttgtc
ctttcagctttggctacagtagaagacttccagattcgtccacatactctctatgtacat
tcttacaaagctcctactttttgtgattattgtggtgagatgctctggggactggtacgt
caaggactgaaatgtgaaggttgtggattaaattatcataaacgatgtgccttcaagatt
ccaaataactgtagtggagtaagaaagaggcgtctgtcaaatgtgtctctgccaggacct
ggcctctcagtcccaagacccctacaaactgaatatgtagcacttcccactgaagagtca
catgttcaccaagaaccaagtaaaagaattccttcttggagtggtcgcccaatctggatg
gaaaagatggtaatgtgcagagtgaaagttccgcacacatttgctgttcactcttatacc
cgtcccacaatatgtcagtactgcaagcggttactgaaaggcctctttcgccaaggaatg
caatgtaaagattgcaaattcaactgtcataaacgctgtgcatcaaaagtaccacgagac
tgccttggagaggttactttcaatggagaaccttccagtctgggaacagatacagatata
ccaatggatatcgacagtagtgacatgaacagtgatggtagtaggggcttggatgacacg
gaagagccatctcccccagaagataaaatgttcttcctggatccatctgatcttgatgtg
gaaagagatgaagaagctgttaaaacaatcagtccatcaacaagcaataatattccgctg
atgagggtcgtacaatccatcaagcacacaaagaggaagagcagcacagtggtaaaggaa
ggatggatggtccatcacaccagcagggacaccttgagaaagaggcattattggagactt
gacagcaaatgtctaacattgtttcaaaatgaatctggatcaaagtattacaaggaaatt
ccactttcagaaattctacgcatatcttcaccacaagatttcacaaacatttcacaaggc
agcaacccacactgttttgaaatcatcactgacactatggtctactttgttggtgagaac
aatggggacagctctcataatcctgttcttgctgccactggagttggacttgatgtagca
cagagctgggaaaaagcaattcgccaagccctcatgcctgtaacccctcaagccagtgtt
tgcacttctccggggcaagggaaagatcacaaagatttgtctactagtatctctgtatct
aattgtcagatccaggagaatgtggacatcagtactgtttaccagatctttgcagatgaa
gtgcttggttcaggccagtttggcatcgtttatggaggaaaacatagaaagactggaagg
gatgtggctattaaagtaattgataagttgagatttcccacaaaacaggaaagtcaactc
cgtaatgaagtggctattttacagaatttgcaccaccctgggattgtaaacctggaatgt
atgtttgaaaccccagaacgagtttttgtagtaatggaaaagctgcatggagatatgttg
gaaatgattctatccagtgagaaaagtcgacttccagaacgaattactaaattcatggtg
acacagatacttgttgctttgaggaatctacattttaagaatattgtgcactgtgactta
aagccagaaaatgtgctactcgcatcagcagagccatttcctcaggtgaagctgtgtgac
tttggttttgcacgcatcattggagaaaagtcattcagaagatctgtggtaggaactcca
gcatacttagcccctgaagttctcagaagcaaaggttacaaccgttctctagatatgtgg
tcagtgggagttattgtctatgtgagcctcagtggcacgtttccttttaatgaagatgaa
gatataaatgaccaaatccaaaatgctgcatttatgtacccaccaaatccatggaaagaa
atttctggtgaagcaattgatttgataaacaacctacttcaagtgaagatgagaaaacgt
tacagtgtggacaaatctctcagtcatccctggctacaggactatcagacttggcttgac
cttagagagtttgaaactcgcattggagaacgttacattacacatgaaagtgatgatgcc
cgctgggaaatacatgcatacacacataaccttgtatacccaaagcacttcatcatggct
cccaatccagatgacatggaagaagatccttaa

DBGET integrated database retrieval system