KEGG   Miniopterus natalensis: 107534491
Entry
107534491         CDS       T05883                                 

Definition
(RefSeq) serum albumin-like
  KO
K16141  serum albumin
Organism
mna  Miniopterus natalensis
Pathway
mna04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    107534491
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107534491
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   107534491
SSDB
Motif
Pfam: Serum_albumin VitD-bind_III
Other DBs
NCBI-GeneID: 107534491
NCBI-ProteinID: XP_016065098
LinkDB
Position
Unknown
AA seq 608 aa
MKGVTFICILFLVSSASSRGLFRRDAPNSQLGHRYKDLGEEHFKSLMLVAFSQILRKSTL
DEILKLTNEITDFAKGCAHDQLAENVCNLFHTTFAYKLCSVASLRASYGDMADCCEKQEP
EINECFLRHKDDKIYFPITVIPEPDAMCTAVQKSEQKFLEQSLYEVARRNPYFYGPELLY
YAQEFIGDLTKCCEAADKVACLGPKISATKKNVLSAASRENFKCSILHAGGESALREWFL
VRLSQKFSCADFMTVSKLVTDLTKTHKECCQSDLLGCADDRADLAKYMCENQTSISSKLA
ECCNKPVLEKSHCLAEMAGDNSVTSLVPLTTDFVENKDGCKNYMEAKDVFLDKFLHEFSR
RHPDYSVSLILRLAKAYEATLEKCCATGDDDACYSKVLDELQPLVDKPQELMHKNCEIFE
KVGWYGFQNALLIRYTKKLPHLSTPTLVDLSHKLADMGSKCCKLPESQRTACSEDNLSSV
VNELCLAHEKTPVSNRVTKCCTESLENRLPCFSSLELDETYVPKVFRTNTFTFHANVCTL
SEFSRQVQKQTLLVELLKHKPKATDEKLKTVTDNFSAFLQKCCAAADKEACFSEEGPKLV
ASSQAVLA
NT seq 1827 nt   +upstreamnt  +downstreamnt
atgaagggggtaactttcatctgtattctctttcttgtcagctctgcttcctccaggggc
ctgtttcgtcgagatgcacccaatagtcagcttggtcatcggtacaaggacctgggagaa
gagcatttcaagagcctcatgctggttgccttttctcagattctccggaagtccacatta
gacgagattttaaaactgacaaatgaaataactgattttgcaaaaggatgtgctcatgac
cagttagctgaaaatgtttgcaacttatttcacaccacttttgcatataaactgtgttca
gtcgcatctcttcgtgcctcctatggggacatggctgactgctgcgagaaacaagagccg
gagataaacgagtgcttcctgagacacaaagatgataagatatacttccctataactgtg
ataccagagcccgatgcaatgtgcactgccgttcagaaaagtgaacagaagtttctggaa
caatccttatatgaagttgccagaagaaatccttacttttatggcccagagctcctttac
tatgctcaagaatttataggagatttaacaaaatgctgtgaagctgctgataaagttgcc
tgcctgggaccaaagattagtgccacaaagaaaaatgtactgtctgcagcttccagagag
aatttcaagtgctccattctccacgctggtggagaaagtgctttgagagaatggttctta
gttcgcctgagccagaaattttcctgtgctgactttatgacggtttccaaattggtgaca
gatcttaccaaaacccacaaggaatgctgccaaagtgacctgcttggatgtgcagatgac
agggcggatcttgccaagtacatgtgtgaaaatcaaacatcaatctccagtaaattggca
gaatgctgtaataagcctgtgttggaaaaatcccactgccttgctgagatggcaggtgat
aattcggttactagcttggtcccattaactactgattttgttgaaaataaggacggttgc
aaaaactatatggaggcaaaagatgtcttcctggacaagtttttgcatgagttctcaaga
aggcatcctgactattctgtctcattgatactgagacttgccaaggcatatgaagctaca
ctggagaagtgctgtgccaccggtgatgatgatgcatgctattccaaagtgttggatgaa
cttcagcctcttgtggataagccacaggaattaatgcacaaaaattgtgaaatttttgaa
aaagttggatggtatggcttccaaaatgcgctgctgattcgttacacaaagaaactaccg
catctgtcaactccaacccttgtggatctctcacacaaactagcagacatgggcagcaag
tgttgtaagcttcccgaatcacaaaggacggcttgttctgaagacaatctgtcctcagtc
gtgaacgagttgtgcttggcacatgagaagacaccagtgagcaacagagttaccaaatgc
tgcacagagtcattggagaacagactgccatgcttttcttctctggaacttgatgaaact
tatgttcccaaagtatttcgtactaatacattcaccttccatgcaaatgtatgcacactt
tctgagttttcgcgacaggtccagaaacaaactttacttgtggagctgttgaaacacaag
cccaaggcaaccgatgaaaaactgaaaactgttacggataatttctcagcttttctacag
aagtgctgcgcagctgctgacaaagaggcctgcttttctgaggagggtccaaaacttgtt
gcttcaagtcaagctgtcttagcctaa

KEGG   Miniopterus natalensis: 107534492
Entry
107534492         CDS       T05883                                 

Gene name
ALB
Definition
(RefSeq) serum albumin
  KO
K16141  serum albumin
Organism
mna  Miniopterus natalensis
Pathway
mna04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    107534492 (ALB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107534492 (ALB)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   107534492 (ALB)
SSDB
Motif
Pfam: Serum_albumin VitD-bind_III
Other DBs
NCBI-GeneID: 107534492
NCBI-ProteinID: XP_016065099
LinkDB
Position
Unknown
AA seq 608 aa
MKGVTFICVLFLVSSASSRGLFRRDAHKSELAHRFKDLGEEHFKGLVLVTFSQYLQQCPF
EEHVKLAKEVTDFAKTCAADESAENCGKSLHTLLGDKLCTVASLRSTYGDMADCCEKQEP
ERNECFLKHKDDNPNLPALVRPEPEALCTSFKENEQKFLGNYLYEVARRNPYFYGPELLY
YAQEYKGVLTECCEAADKAACLGPKMDALKERVLTSAVKQRMKCSSLQKFGDRAFKAWSV
ARLSQRFPNADFMEVSKMVNDLTKIHKECCQGDLLECADDRADLAKYMCENQESVSSKLK
ECCAKPLLEKSHCLSEVENDDLPSDLAPINADYVDDKEVCKNYKEAKDVFLGTFLYEYSR
RHPDYAVSLILRLAKKYEATLEKCCATDDPHACYSKVLDELQPLVDESKELVKKNCEVYE
SLGEYGFQNALVVRYTKRAPKVSTPTLVDLSRKLGRVGSKCCKLPESKRMGCAEDYLSLV
LNGLCVAHEKTPVSDRVTKCCTESLVNRRPCFSSLGDDDTYVPKEFNAETFTFHADVCTL
PETEQQVKKQTLLVELLKHKPKATDEKLKTVTDNFSAFLQKCCAAADKEACFSEEGPKLV
ASSQAVLA
NT seq 1827 nt   +upstreamnt  +downstreamnt
atgaagggggtaactttcatctgtgttctctttcttgtcagctctgcttcctccaggggc
ctgtttcgtcgagatgcacacaagagtgagcttgctcatcggttcaaggatctgggagaa
gagcatttcaagggcctggtgctggttaccttttctcagtatctccagcagtgcccattt
gaagagcatgtaaaattagcaaaggaagtaactgattttgcaaaaacatgtgctgctgat
gagtcagctgaaaattgtggaaagtcacttcacacccttctgggagataaactgtgtaca
gtcgcatctcttcgatccacctatggggacatggctgactgctgcgagaaacaagagccc
gagaggaacgagtgcttcctgaaacacaaggacgacaaccccaacctccccgcactggtg
aggccagagcctgaggccctgtgcacctccttcaaggaaaatgagcagaagttcctggga
aattacctatatgaagttgccagaagaaatccttacttttatggcccagagcttctttac
tatgctcaagaatataaaggagttttgacagaatgctgtgaagctgctgataaagctgcc
tgcctgggaccaaagatggatgctctgaaggaaagagtactgacttcagctgtcaaacag
agaatgaagtgctccagtctccaaaaattcggagatagagctttcaaagcatggtctgta
gctcgtctgagccagagatttcccaatgctgactttatggaggtttccaagatggtgaat
gatcttaccaaaatccacaaagaatgctgccagggtgacctgcttgaatgtgcagatgac
agggcggatcttgccaagtacatgtgtgaaaatcaagaatcagtctccagtaaattgaag
gaatgctgtgctaagcctctgttggaaaaatcccactgcctttctgaggtggaaaatgat
gacttgcctagcgatttggccccgataaatgctgattatgttgacgataaggaagtttgc
aaaaactacaaagaggcaaaagatgtcttcctgggcacgtttttgtatgagtactcaaga
agacatcctgactatgctgtgtcattgatactgagacttgccaagaaatatgaagctaca
ctggagaagtgctgtgccaccgatgatcctcatgcatgctattccaaagtgttggatgaa
cttcagcctcttgtggatgagtcaaaggaattagtcaagaaaaactgtgaagtttatgaa
agccttggagagtatggcttccaaaatgccctggtggtgcgttacaccaagagggcaccc
aaagtatcgactccaactcttgtggatctctcaagaaaactaggacgagtgggcagcaag
tgttgtaagcttcctgagtcaaaaagaatgggttgtgctgaagactatctgtccctggtc
ttgaatgggttatgtgtggcccacgagaagacaccagtgagtgacagagttaccaaatgc
tgcacagagtcattggtgaacagacggccatgcttttcttctctgggagatgatgatacc
tatgttcccaaagaatttaatgctgaaacgttcaccttccatgcagatgtatgcacactt
cccgagactgagcaacaagtgaagaaacaaactttacttgtggagctgttgaaacacaag
cccaaggcaaccgatgaaaaactgaaaactgttacggataatttctcagcttttctacag
aagtgctgcgcagctgctgacaaagaggcctgcttttctgaggagggtccaaaacttgtt
gcttcaagtcaagctgtcttagcctaa

DBGET integrated database retrieval system