KEGG   Miniopterus natalensis: 107534638
Entry
107534638         CDS       T05883                                 

Gene name
SCTR
Definition
(RefSeq) secretin receptor
  KO
K04588  secretin receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04972  Pancreatic secretion
mna04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107534638 (SCTR)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    107534638 (SCTR)
   04976 Bile secretion
    107534638 (SCTR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107534638 (SCTR)
G protein-coupled receptors [BR:mna04030]
 Secretin receptor family
  Gut peptide
   Secretin
    107534638 (SCTR)
SSDB
Motif
Pfam: 7tm_2 HRM Insulin_TMD
Other DBs
NCBI-GeneID: 107534638
NCBI-ProteinID: XP_016065285
LinkDB
Position
Unknown
AA seq 438 aa
MSQRDVQFETIGALPRLCDVLRVLREERDQCLQELSKERTEDLGTVQPTPGCAGLWDNMS
CWPSSEPGQTVEVECPRFLWMLSGRNGSIFRNCTQGGWSEAFPRPDLACGVNVNDSSNET
NKKRHEYLLKLKVMYTVGYSSSLVMLLVALSILCSFRRLHCTRNYIHMHLFVSFILRALS
NFIKDAVLFSDDGLHCDTHRVGCKLVMVFFQYCIVANYAWLLVEGLYLHTLLAISFFSEK
KCLQGCVALGWGSPAIFVTSWAITRHFLEDVGCWDINANASVWWVIRGPVILSILINFIL
FINILRILMRKLRTQETRGNEVNHYKRLAKSTLLLIPLFGAHYIIFAFSPDEAMEIQLFF
ELALGSFQGLVVAVLYCFLNGEVQLEVQKKWRQWHLRELPLRPVALSNSFSIGTSSLTHG
TKASPSESSRGTWRTSVI
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgtcgcagcgggacgtccagtttgaaaccattggagccctccctcgactgtgtgacgtg
ctccgggtgctgcgggaggagcgggaccagtgcctgcaggaactctccaaagagaggaca
gaagacctaggcactgtgcagccaaccccaggctgcgcggggctgtgggacaacatgagc
tgctggccctcctccgagcctggacagacggtggaagtggagtgtccgcgattcctctgg
atgctctcgggcaggaacggttccatatttcgaaactgcacccagggcggctggtcagaa
gccttccccaggcctgacctggcctgtggggttaacgtgaatgactcgtccaacgaaacc
aacaagaagcggcacgagtacctgctgaagctgaaggtcatgtacaccgtgggctatagc
tcctccctggtgatgctcctggtggccctcagcatcctctgttctttccggaggctccac
tgcacccgcaactacatccacatgcacctgttcgtgtccttcatcctgcgcgctctgtcc
aacttcatcaaggatgctgtgctcttctcagacgacggtctccactgcgatacccacagg
gtggggtgcaagctggtcatggtcttcttccagtactgcatagtggccaactacgcctgg
ctgctggtggagggcctctaccttcacaccctcctcgccatctccttcttctcagaaaag
aagtgcctacagggctgtgtcgccctgggctggggttccccagccatttttgtcacttcg
tgggctatcaccagacactttctggaagatgttgggtgctgggacatcaacgccaacgcg
tccgtctggtgggtcattcgagggcctgtgatcctgtccatcctgattaatttcatcctg
tttataaacattctaagaatcctgatgagaaaactcagaacccaagaaacaagaggaaat
gaagtaaaccattataagcgcctggccaagtccaccctcctgctgatccctctcttcggc
gcccactatatcatctttgccttctcgccagatgaggccatggagatccagctgtttttt
gaacttgcccttggctcattccagggcctggtggtggctgtcctctactgcttcctcaac
ggggaggtgcagctggaggttcagaagaagtggcggcagtggcacctgcgcgagctcccc
ctgcgccctgtggccctcagcaactcctttagcattggcaccagcagcctcacccacggc
accaaggccagcccctcagagtcgagccggggcacctggaggaccagcgtcatctga

DBGET integrated database retrieval system