KEGG   Miniopterus natalensis: 107534685
Entry
107534685         CDS       T05883                                 

Gene name
SLC6A11
Definition
(RefSeq) sodium- and chloride-dependent GABA transporter 3
  KO
K05044  solute carrier family 6 (neurotransmitter transporter, GABA) member 11
Organism
mna  Miniopterus natalensis
Pathway
mna04721  Synaptic vesicle cycle
mna04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107534685 (SLC6A11)
   04721 Synaptic vesicle cycle
    107534685 (SLC6A11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107534685 (SLC6A11)
Transporters [BR:mna02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   107534685 (SLC6A11)
SSDB
Motif
Pfam: SNF
Other DBs
NCBI-GeneID: 107534685
NCBI-ProteinID: XP_016065334
LinkDB
Position
Unknown
AA seq 577 aa
MTAVVELQGLVKEPSLGLHGRFHSRPRGPAGAFLIPYVVFFICCGIPVFFLETALGQFTS
EGGITCWRKICPLFEGIGYATQVIEAHLNVYYIIILAWAIFYLCNCFTTELPWATCGHEW
NTEKCVEFQKLNMSNHSHVSLQNATSPVMEFWERRVLAISDGIEHIGNLRWELALCLLAA
WTICYFCIWKGTKSTGKVVYVTATFPYVMLLILLIRGVTLPGASEGIKFYLYPDLSRLSD
PQVWVDAGTQIFFSYAICLGCLTALGSYNNYNNNCYRDCIMLCCLNSGTSFVAGFAIFSV
LGFMAYEQGVPIAEVAESGPGLAFIAYPKAVTMMPLSPLWATLFFMMLIFLGLDSQFVCV
ESLVTAVVDMYPKVFRRGYRRELLILALSIVSYFLGLVMLTEGGMYIFQLFDSYAASGMC
LLFVAIFECVCIGWVYGSNRFYDNIEDMIGYRPLSLIKWCWKVVTPGICAGIFIFFLVKY
KPLKYNNIYTYPAWGYGIGWLMALSSMLCIPLWIFIKMWKTEGTLLEKFRKLVIPSADLK
MRGKLGAGPRTVMVNDCDTKLKGDGTIAAITEKETHF
NT seq 1734 nt   +upstreamnt  +downstreamnt
atgacagcggtggtggaacttcaaggcttggtgaaggaacccagcctaggcctgcatggg
cggttccactcccgtcctagggggccggcgggggcattcctgattccctacgtggtgttt
tttatttgttgtggaattcctgtttttttcctggaaacggctctgggccagttcacgagt
gaaggtggcattacatgttggaggaaaatttgccctttatttgaaggcattggctatgca
acacaggtgatcgaggcccatctaaatgtgtattacatcatcatcttggcgtgggccatt
ttctacctgtgcaactgcttcaccactgagctcccctgggccacctgtgggcatgagtgg
aacacagagaaatgtgtggagttccagaaactgaacatgagtaaccacagccatgtgtcc
ctgcagaatgccacctctcctgtcatggagttttgggagcgccgggtcctggccatctcg
gatgggattgagcacattgggaacctccgctgggagctggccttgtgtcttttggcagcc
tggaccatctgctacttctgtatctggaagggaaccaagtccacaggaaaggttgtatat
gtcactgcgacattcccctatgttatgcttctgattctcctgatccgaggggtcacgttg
cctggggcctccgaaggcatcaagttctacctgtaccctgacctctccaggctctccgac
ccacaggtctgggtagatgctggaacgcagatctttttctcctatgccatctgcctgggt
tgtctgactgctctgggaagttataacaattataacaacaactgctacagggactgcatc
atgctctgttgcctgaacagtggcaccagctttgtggctggctttgccatcttctcggtc
ctgggcttcatggcgtatgagcagggggtgcctattgctgaagtggcagagtcaggccct
ggcctggcctttatcgcttaccccaaggctgtcaccatgatgcctctctccccactgtgg
gccaccttgttcttcatgatgctcatcttcctgggcctggacagccagtttgtgtgtgta
gaaagccttgtgaccgccgtggtggacatgtaccccaaggtcttccggaggggctatcgg
cgggagctacttatcctggccctgtcaatcgtctcctattttctgggcctcgtgatgtta
acagagggtggcatgtacatcttccagctctttgactcctatgccgccagtgggatgtgc
cttctctttgtggccatctttgagtgtgtctgcattggctgggtgtatggaagcaaccgc
ttctatgataacatcgaagacatgattggctaccggccattgtcactcattaaatggtgc
tggaaggtcgtgacccccgggatctgtgcgggcatcttcatcttttttctggtcaagtac
aagcctctcaaatataataacatctacacctaccccgcctggggctatggcataggctgg
cttatggccctgtcttccatgctctgcatccccctttggatcttcatcaagatgtggaag
acagaggggacactgcttgagaaattccggaagttggtgatccccagtgctgatctgaaa
atgaggggcaagcttggggcaggcccacggacggtgatggttaatgactgtgacaccaaa
ctcaagggcgatgggaccattgcagccatcacagaaaaggagacgcacttctga

KEGG   Miniopterus natalensis: 107546420
Entry
107546420         CDS       T05883                                 

Gene name
SLC6A13
Definition
(RefSeq) sodium- and chloride-dependent GABA transporter 2
  KO
K05046  solute carrier family 6 (neurotransmitter transporter, GABA) member 13
Organism
mna  Miniopterus natalensis
Pathway
mna04721  Synaptic vesicle cycle
mna04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107546420 (SLC6A13)
   04721 Synaptic vesicle cycle
    107546420 (SLC6A13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107546420 (SLC6A13)
Transporters [BR:mna02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   107546420 (SLC6A13)
SSDB
Motif
Pfam: SNF
Other DBs
NCBI-GeneID: 107546420
NCBI-ProteinID: XP_016080288
LinkDB
Position
Unknown
AA seq 602 aa
MDSRLSSPASNGETKPVYPVVEKAEEDGTLERGHWNNKMEFVLSVAGEIIGLGNVWRFPY
LCYKNGGGAFFIPYLIFLFTCGIPIFLLETALGQYTSQGGITAWRKICPIFEGIGYASQV
VLILLNAYYIIVLAWALFYLFSSFTIDLPWGSCRHEWNTEHCVEFQRTNGSLNMTSENAT
SPVIEFWERRVLKISDGIQHLGALRWELAICLLLAWVICYFCIWKGVKSTGKVVYFTATF
PYLMLVVLLIRGVTLPGAAQGIQFYLYPNLTRLWDPQVWMDAGTQIFFSFAICVGCLTAL
SSYNKYHNNCYRDCMALCFLNSGTSFVAGFAIFSILGFMSQEQGVPISEVAESGPGLAFI
AYPRAVVMLPFSPLWACCFFFMIILLGLDSQFVCVESLVTALVDMYPRVFRKKNRREVLI
LGVSVISFLVGLVMVTEGGMYVFQLFDNYAASGMCLLFVAIFESLCVAWVYGAGRFYDNI
EDMIGYRPWPLIKYCWLFLTPAVCTATFLFSLIKYTPLTYNKKYMYPWWGDALGWLLALS
SMVCIPAWSFYKLSTLKGSFRERIRQLVCPAEELAQRNQAGPSAPATPRTSLLRLTELES
HC
NT seq 1809 nt   +upstreamnt  +downstreamnt
atggacagccggctctccagcccagccagtaatggagagacaaaacctgtgtacccagtg
gtggaaaaggcggaggaagatggcaccctggaacgggggcactggaacaacaagatggag
tttgtgctgtccgtggccggggagatcattgggctgggcaacgtctggaggtttccctat
ctctgctacaaaaatgggggaggtgcttttttcatcccctacctcatcttccttttcacc
tgtggcattcccatcttcctcttggagacagcgctgggccagtacactagccagggaggc
attacagcctggaggaagatctgccccatctttgaaggcatcggctacgcctcccaggtg
gtcctcatcctcctcaacgcctactacatcatcgtcttggcttgggccctcttctacctc
tttagcagcttcaccatcgaccttccctggggaagctgccgccatgagtggaatacagaa
cactgtgtggagttccagaggaccaatggctccctgaatatgacctctgagaatgccacc
tctcctgtcatcgagttctgggagaggcgggtcctgaagatctctgatggcatccagcac
ctgggggccctgcgctgggaactagccatatgcctcttgcttgcctgggtcatctgctac
ttctgcatctggaagggggtcaagtccaccggcaaggtggtgtacttcacagccacattc
ccttacctcatgctggtggtcctgctaattcgaggggtgacactgcctggggcagcccaa
gggattcagttttacctgtatccaaacctcacccgtctgtgggatccccaggtgtggatg
gacgcgggcacccagatcttcttctccttcgccatctgtgtagggtgcctgacagccctg
agcagctacaacaagtaccacaacaactgctacagggactgcatggccctctgcttcctc
aacagtggcaccagctttgtggcggggtttgccatcttctccatcctgggcttcatgtcc
caagagcagggggtgcccatctccgaggtggctgagtcaggccctggcctggctttcatc
gcctacccccgggctgtggtgatgctgcccttttctcctctctgggcctgctgcttcttc
ttcatgatcatcctcctgggactggatagccagtttgtgtgcgtagaaagcctggtgaca
gcgctggtggatatgtacccccgtgtgttccgcaagaagaaccgaagggaggtcctcatc
cttggggtgtctgtcatctccttccttgttgggctggtcatggtcacagagggcggtatg
tatgtgtttcagctttttgacaactatgcagccagtggcatgtgcctgctgttcgtggcc
atctttgagtccctctgtgtggcttgggtctatggagctgggcgcttctatgacaacatt
gaagatatgattgggtacaggccttggcctcttatcaaatattgctggctcttcctcaca
ccagctgtgtgcacagccaccttcctcttctccctgatcaagtacaccccactgacctac
aacaagaagtacatgtacccctggtggggggatgccctgggctggctcctggctctgtcc
tccatggtctgtattcctgcctggagtttctacaaactcagcaccctcaagggctccttc
agagagagaattcgccagctcgtgtgcccagctgaggaactggcccaacggaaccaagca
ggaccctctgcccctgctacacccaggacatcacttctcagactcacagaactagagtct
cactgctag

DBGET integrated database retrieval system