KEGG   Miniopterus natalensis: 107534729
Entry
107534729         CDS       T05883                                 

Gene name
RAF1
Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna01522  Endocrine resistance
mna04010  MAPK signaling pathway
mna04012  ErbB signaling pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04062  Chemokine signaling pathway
mna04068  FoxO signaling pathway
mna04071  Sphingolipid signaling pathway
mna04072  Phospholipase D signaling pathway
mna04140  Autophagy - animal
mna04150  mTOR signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04210  Apoptosis
mna04218  Cellular senescence
mna04270  Vascular smooth muscle contraction
mna04360  Axon guidance
mna04370  VEGF signaling pathway
mna04371  Apelin signaling pathway
mna04510  Focal adhesion
mna04540  Gap junction
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04613  Neutrophil extracellular trap formation
mna04625  C-type lectin receptor signaling pathway
mna04630  JAK-STAT signaling pathway
mna04650  Natural killer cell mediated cytotoxicity
mna04660  T cell receptor signaling pathway
mna04662  B cell receptor signaling pathway
mna04664  Fc epsilon RI signaling pathway
mna04666  Fc gamma R-mediated phagocytosis
mna04720  Long-term potentiation
mna04722  Neurotrophin signaling pathway
mna04726  Serotonergic synapse
mna04730  Long-term depression
mna04810  Regulation of actin cytoskeleton
mna04910  Insulin signaling pathway
mna04912  GnRH signaling pathway
mna04914  Progesterone-mediated oocyte maturation
mna04915  Estrogen signaling pathway
mna04916  Melanogenesis
mna04917  Prolactin signaling pathway
mna04919  Thyroid hormone signaling pathway
mna04921  Oxytocin signaling pathway
mna04926  Relaxin signaling pathway
mna04928  Parathyroid hormone synthesis, secretion and action
mna04929  GnRH secretion
mna04935  Growth hormone synthesis, secretion and action
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05034  Alcoholism
mna05132  Salmonella infection
mna05152  Tuberculosis
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05163  Human cytomegalovirus infection
mna05164  Influenza A
mna05165  Human papillomavirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05206  MicroRNAs in cancer
mna05210  Colorectal cancer
mna05211  Renal cell carcinoma
mna05212  Pancreatic cancer
mna05213  Endometrial cancer
mna05214  Glioma
mna05215  Prostate cancer
mna05218  Melanoma
mna05219  Bladder cancer
mna05220  Chronic myeloid leukemia
mna05221  Acute myeloid leukemia
mna05223  Non-small cell lung cancer
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
mna05230  Central carbon metabolism in cancer
mna05231  Choline metabolism in cancer
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107534729 (RAF1)
   04012 ErbB signaling pathway
    107534729 (RAF1)
   04014 Ras signaling pathway
    107534729 (RAF1)
   04015 Rap1 signaling pathway
    107534729 (RAF1)
   04370 VEGF signaling pathway
    107534729 (RAF1)
   04371 Apelin signaling pathway
    107534729 (RAF1)
   04630 JAK-STAT signaling pathway
    107534729 (RAF1)
   04068 FoxO signaling pathway
    107534729 (RAF1)
   04072 Phospholipase D signaling pathway
    107534729 (RAF1)
   04071 Sphingolipid signaling pathway
    107534729 (RAF1)
   04024 cAMP signaling pathway
    107534729 (RAF1)
   04022 cGMP-PKG signaling pathway
    107534729 (RAF1)
   04151 PI3K-Akt signaling pathway
    107534729 (RAF1)
   04150 mTOR signaling pathway
    107534729 (RAF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107534729 (RAF1)
  09143 Cell growth and death
   04210 Apoptosis
    107534729 (RAF1)
   04218 Cellular senescence
    107534729 (RAF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107534729 (RAF1)
   04540 Gap junction
    107534729 (RAF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    107534729 (RAF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107534729 (RAF1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107534729 (RAF1)
   04625 C-type lectin receptor signaling pathway
    107534729 (RAF1)
   04650 Natural killer cell mediated cytotoxicity
    107534729 (RAF1)
   04660 T cell receptor signaling pathway
    107534729 (RAF1)
   04662 B cell receptor signaling pathway
    107534729 (RAF1)
   04664 Fc epsilon RI signaling pathway
    107534729 (RAF1)
   04666 Fc gamma R-mediated phagocytosis
    107534729 (RAF1)
   04062 Chemokine signaling pathway
    107534729 (RAF1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107534729 (RAF1)
   04929 GnRH secretion
    107534729 (RAF1)
   04912 GnRH signaling pathway
    107534729 (RAF1)
   04915 Estrogen signaling pathway
    107534729 (RAF1)
   04914 Progesterone-mediated oocyte maturation
    107534729 (RAF1)
   04917 Prolactin signaling pathway
    107534729 (RAF1)
   04921 Oxytocin signaling pathway
    107534729 (RAF1)
   04926 Relaxin signaling pathway
    107534729 (RAF1)
   04935 Growth hormone synthesis, secretion and action
    107534729 (RAF1)
   04919 Thyroid hormone signaling pathway
    107534729 (RAF1)
   04928 Parathyroid hormone synthesis, secretion and action
    107534729 (RAF1)
   04916 Melanogenesis
    107534729 (RAF1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107534729 (RAF1)
  09156 Nervous system
   04726 Serotonergic synapse
    107534729 (RAF1)
   04720 Long-term potentiation
    107534729 (RAF1)
   04730 Long-term depression
    107534729 (RAF1)
   04722 Neurotrophin signaling pathway
    107534729 (RAF1)
  09158 Development and regeneration
   04360 Axon guidance
    107534729 (RAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107534729 (RAF1)
   05206 MicroRNAs in cancer
    107534729 (RAF1)
   05205 Proteoglycans in cancer
    107534729 (RAF1)
   05230 Central carbon metabolism in cancer
    107534729 (RAF1)
   05231 Choline metabolism in cancer
    107534729 (RAF1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107534729 (RAF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107534729 (RAF1)
   05212 Pancreatic cancer
    107534729 (RAF1)
   05225 Hepatocellular carcinoma
    107534729 (RAF1)
   05226 Gastric cancer
    107534729 (RAF1)
   05214 Glioma
    107534729 (RAF1)
   05221 Acute myeloid leukemia
    107534729 (RAF1)
   05220 Chronic myeloid leukemia
    107534729 (RAF1)
   05218 Melanoma
    107534729 (RAF1)
   05211 Renal cell carcinoma
    107534729 (RAF1)
   05219 Bladder cancer
    107534729 (RAF1)
   05215 Prostate cancer
    107534729 (RAF1)
   05213 Endometrial cancer
    107534729 (RAF1)
   05224 Breast cancer
    107534729 (RAF1)
   05223 Non-small cell lung cancer
    107534729 (RAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107534729 (RAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    107534729 (RAF1)
  09165 Substance dependence
   05034 Alcoholism
    107534729 (RAF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107534729 (RAF1)
   05152 Tuberculosis
    107534729 (RAF1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107534729 (RAF1)
   05161 Hepatitis B
    107534729 (RAF1)
   05160 Hepatitis C
    107534729 (RAF1)
   05164 Influenza A
    107534729 (RAF1)
   05163 Human cytomegalovirus infection
    107534729 (RAF1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107534729 (RAF1)
   05165 Human papillomavirus infection
    107534729 (RAF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107534729 (RAF1)
   01522 Endocrine resistance
    107534729 (RAF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107534729 (RAF1)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107534729 (RAF1)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   107534729 (RAF1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2
Other DBs
NCBI-GeneID: 107534729
NCBI-ProteinID: XP_016065391
LinkDB
Position
Unknown
AA seq 648 aa
MEHIQGAWKTISNGFGFKDAVFDGPSCISPTIVQQFGYQRRASDDGKLTDSSKTSSTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDMCQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNVRQLLLFPNSTIGDSGVPALPSLPVRRMREPVCRMPVSSQHRYSTPHAFTF
NTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIEDAIRSHSESASPSALSSSPNNL
SPTGWSQPKTPVPAQRERAPGSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSF
GTVYKGKWHGDVAVKILKVVDPTPEQLQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIV
TQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGL
TVKIGDFGLATVKSRWSGSQQVEQPTGSILWMAPEVIRMQDNNPFSFQSDVYSYGIVLYE
LMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCVKKVKEERPLFP
QILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLTTSPRLPVF
NT seq 1947 nt   +upstreamnt  +downstreamnt
atggagcacatacagggggcctggaagacgatcagcaatggttttggattcaaagacgca
gtgtttgacggccccagctgcatttcccccacaatagttcagcagtttggctatcagcgc
cgagcatcagatgatggcaaacttacggattcctctaagacaagcagtactatccgtgtt
ttcttgccaaacaagcagagaacagtggtcaatgtacgaaatggaatgagcttgcatgac
tgccttatgaaagcactcaaggtgaggggcctgcaaccagagtgctgtgcagtgttcaga
cttctccacgaacacaaaggtaaaaaagcacgtttagattggaatactgatgctgcctca
ttgattggagaagaacttcaagtagatttcttggatcatgttcctctcacaacacacaac
tttgctcggaagaccttcctgaagcttgccttctgtgacatgtgtcagaagttcctgcta
aatggatttcgatgtcagacttgtggctacaaatttcatgagcactgtagcactaaagta
cctactatgtgtgtggactggagtaatgtcaggcaactcttattgtttccaaattccact
attggtgatagtggggtcccagcactgccttctttgccagtgcgtcggatgcgagagcct
gtttgccggatgcctgttagttcccagcacagatactccacgccccacgccttcacattc
aacacctccagcccctcctctgaaggttccctctcccagaggcagaggtcgacgtccaca
cctaatgtccacatggtcagcaccaccctgcctgtggacagcaggatgatcgaggatgca
attcgaagtcacagtgaatcagcctcaccgtcagccttgtccagcagccccaacaatctg
agcccaacaggctggtcacagcccaaaacccctgtgccggcacagagagaacgggcacca
ggatctgggacccaggagaaaaacaaaattaggcctcgtggacagagagattcaagctat
tactgggaaatagaagccagtgaagtgatgctgtctactcggattgggtcaggctccttt
ggaactgtttataagggcaagtggcatggagacgttgcagtaaagatcctaaaggtggtt
gaccctacaccagagcagttgcaggccttcaggaacgaggtggctgtcctgcgcaaaaca
cggcacgtgaacatcctgctcttcatggggtacatgacgaaggacaacctggccattgtg
acccagtggtgcgagggtagcagcctctacaaacacctgcatgtccaagagaccaagttc
cagatgttccagttgattgacattgcccggcagactgctcagggaatggactatttgcat
gcaaagaacatcatccacagagacatgaaatccaacaatatatttctccatgaaggcctg
acagtgaaaattggagattttggtttggcaacagtaaagtcacgctggagtggttctcag
caggttgaacaacccaccggctctatcctgtggatggccccagaggtgatccgaatgcag
gataataacccattcagcttccagtctgacgtctactcctatggcattgtgctgtatgag
ctcatgacaggggagctaccttactcccacatcaacaaccgagatcagatcatcttcatg
gtgggccgagggtatgcatccccagaccttagtaagctgtacaagaactgccccaaagca
atgaagcggcttgtagccgactgtgtgaagaaagttaaggaagagaggcccctttttccc
cagatcctgtcttccattgagctgctccaacactctctaccgaaaatcaaccggagcgct
tctgagccatccctgcatcgggcggcccacactgaggatatcaatgcctgcacgctgacc
acgtctcctagactgcctgtcttctag

DBGET integrated database retrieval system