KEGG   Miniopterus natalensis: 107534770
Entry
107534770         CDS       T05883                                 

Gene name
ATP2B2
Definition
(RefSeq) plasma membrane calcium-transporting ATPase 2 isoform X1
  KO
K05850  P-type Ca2+ transporter type 2B [EC:7.2.2.10]
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04925  Aldosterone synthesis and secretion
mna04961  Endocrine and other factor-regulated calcium reabsorption
mna04970  Salivary secretion
mna04972  Pancreatic secretion
mna04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107534770 (ATP2B2)
   04024 cAMP signaling pathway
    107534770 (ATP2B2)
   04022 cGMP-PKG signaling pathway
    107534770 (ATP2B2)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    107534770 (ATP2B2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107534770 (ATP2B2)
  09154 Digestive system
   04970 Salivary secretion
    107534770 (ATP2B2)
   04972 Pancreatic secretion
    107534770 (ATP2B2)
   04978 Mineral absorption
    107534770 (ATP2B2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    107534770 (ATP2B2)
Enzymes [BR:mna01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     107534770 (ATP2B2)
SSDB
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase ATP_Ca_trans_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3 EMC3_TMCO1
Other DBs
NCBI-GeneID: 107534770
NCBI-ProteinID: XP_016065456
LinkDB
Position
Unknown
AA seq 1243 aa
MGDMTNSDFYSKNQRNESSHGGEFGCTLEELRSLMELRSTEAVVKIKETYGDTEAICRRL
KTSPIEGLPGTAPDLEKRKQIFGQNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIISLG
LSFYHPPGESNEGCATAQAGSEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFR
GLQSRIEQEQKFTVVRAGQVVQIPVAEIVVGDIAQIKYGDLLPADGLFIQGNDLKIDESS
LTGESDQVRKSVDKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKD
KKGVKKGDGLQLPAADGAAGSNAADSANTSLVNGKMQDGTVDASQSKAKQQDGAAAMEMQ
PLKSAEGGDADDKKKANMHKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFTVDT
FVVNKKPWLPECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNL
VRHLDACETMGNATAICSDKTGTLTTNRMTVVQAYLGDVHYKEIPDPGSINAKTMELLVN
AIAINSAYTTKILPPEKEGALPRQVGNKTECGLLGFVLDLKQDYEAVRSQMPEEKLYKVY
TFNSVRKSMSTVIKLPDESFRMYSKGASEIVLKKCCKILNGAGEPRVFRPRDRDEMVKKV
IEPMACDGLRTICVAYRDFPSSPEPDWDNENDILNDLTCICVVGIEDPVRPEVPEAIRKC
QRAGITVRMVTGDNINTARAIAIKCGIIHPGEDFLCLEGKEFNQRIRNEKGEIEQERIDK
IWPKLRVLARSSPTDKHTLVKGIIDSTHTEQRQVVAVTGDGTNDGPALKKADVGFAMGIA
GTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACIT
QDSPLKAVQMLWVNLIMDTFASLALATEPPTETLLLRKPYGRNKPLISRTMMKNILGHAV
YQLTLIFTLLFVGEKMFQIDSGRNAPLHSPPSEHYTIIFNTFVMMQLFNEINARKIHGER
NVFDGIFRNPIFCTIVLGTFAIQIVIVQFGGKPFSCSPLQLDQWMWCIFIGLGELVWGQV
IATIPTSRLKFLKEAGRLTQKEEIPEEELNEDVEEIDHAERELRRGQILWFRGLNRIQTQ
IRVVKAFRSSLYEGLEKPESRTSIHNFMAHPEFRIEDSQPHIPLIDDTDLEEDAALKQNS
SPPSSLNKNNSAIDSGINLTTDTSKSATSSSPGSPIHSLETSL
NT seq 3732 nt   +upstreamnt  +downstreamnt
atgggtgacatgaccaacagcgacttttactccaaaaaccaaagaaacgagtcgagccat
gggggcgagtttgggtgcacgctggaggagctccgctccctcatggagctgcggagcact
gaggctgtggtcaagatcaaggagacttacggggacaccgaagccatctgccggcgcctc
aaaacctcacctatcgaaggtttgccaggtaccgctccagacctagaaaagagaaagcag
atttttggacaaaactttatacctcctaagaagccaaaaaccttcctgcagctcgtgtgg
gaagcgctgcaagatgtgacgctgatcatcctggaaattgcggccatcatctccctgggg
ctgtctttctaccacccgcctggcgagagcaatgaaggatgtgccacagcccaggctggg
tcagaggatgaaggggaggcggaggcaggctggattgagggggctgccatccttctctca
gtcatctgtgtggtcctggtcacggccttcaatgactggagcaaagagaagcagttccgg
ggcctgcagagccgcatcgagcaggagcagaagttcaccgtggtccgggctggccaggtg
gtccagatccctgtggctgagattgtggttggggacatcgcccaaatcaaatatggtgat
ctcctccctgccgatggcctcttcatccagggcaatgacctcaagattgatgaaagctcc
ttgacaggggagtctgaccaggtgcgcaagtctgtggacaaggaccccatgctgctgtca
gggacgcacgtgatggagggctctggacggatggtggtgaccgctgtgggtgtgaactct
caaactggcattatctttaccctgctgggggctggcggtgaagaggaagaaaagaaagac
aagaaaggtgtgaagaagggggatggccttcagctaccagcggccgatggtgcggcaggt
tcaaatgctgcagatagtgcaaataccagcctagtcaatggtaaaatgcaggatggcact
gtggacgccagccagagcaaagccaaacagcaggatggggcagccgccatggagatgcag
cccctcaagagtgctgagggcggcgacgctgacgacaagaagaaagccaacatgcacaag
aaggagaagtcggtgctccagggcaagctcaccaagctggctgtgcagatcggcaaggcg
ggcctggtgatgtcggccatcacggtgatcatcctggtgctgtacttcaccgtggacacc
tttgtggtcaacaagaagccatggctacccgagtgcacacctgtctacgtgcagtacttt
gtcaagttcttcatcattggtgtgacggtgctggtggtcgccgtgcccgaggggctccct
ctggccgtcaccatctcgctggcctactctgtgaagaaaatgatgaaggacaacaacctg
gtacgccacctggacgcctgcgagaccatgggcaatgccacggccatctgctcggacaag
acgggcacgctgacgaccaatcgcatgacggtagtgcaggcctaccttggcgatgtccac
tacaaggagatccccgaccccggctccatcaacgccaagaccatggagctgctggtcaac
gccatcgccatcaacagcgcctacaccaccaaaattctgccaccggagaaggagggggca
ctgcctcggcaggtgggcaacaagactgagtgtggcctgctgggcttcgtgctggacctg
aagcaggactacgaggctgtgcgcagccagatgccagaggagaagctgtacaaagtgtac
acattcaactctgtgcgcaagtccatgagcacagtcattaagctgcccgacgagagcttc
cgcatgtacagcaagggcgcatctgagatcgtgctcaagaagtgctgcaaaatcctcaac
ggggcaggcgagccccgggtcttccggccccgtgaccgtgatgagatggtgaagaaggtg
attgagcccatggcctgtgacgggctccgcaccatctgtgtggcctaccgcgacttcccc
agcagccccgagcctgactgggataatgagaatgacatcctgaacgacctcacctgcatc
tgcgtggtgggcatcgaggaccccgtgcggcctgaggtcccagaagccatccgaaagtgc
cagcgggcaggcatcacagtccgcatggtcaccggcgacaatatcaacacagcccgggct
atcgccatcaagtgtggcatcatccatcctggggaggactttctgtgccttgagggcaag
gagttcaaccagaggatccggaacgagaagggggagattgagcaggagcgaatcgacaag
atctggccaaagcttcgggtgctggctcgctcctcgcccacggacaagcataccctcgtc
aaaggtatcatcgacagcacgcacactgagcagcggcaggtggtggcggtgacaggggat
ggcaccaatgatggtcctgcactcaagaaggccgacgtgggctttgccatgggcattgca
ggcacagacgtggccaaagaagcctcggacatcatcctgacagatgacaacttcagcagc
atcgtcaaggcggtgatgtggggccgcaatgtctatgacagcatatccaagttcctgcag
ttccagctgacagtcaatgtggtggctgtgattgtggccttcacaggtgcctgcatcaca
caggactcccctctgaaggccgtgcagatgctctgggtgaatctcatcatggacacgttt
gcctcgctggcgctggccaccgagccgcccaccgagaccctgcttctgaggaagccgtat
ggccgcaacaagcccctcatctcacgcaccatgatgaagaatatcctgggccacgccgtg
taccagctcaccctcatcttcacactgctctttgtcggtgaaaagatgttccagattgac
agtgggaggaacgcgcccctgcactcgccgccctcagagcactacaccatcatcttcaac
accttcgtcatgatgcagctcttcaacgagatcaacgcccgcaagatccacggcgagcgc
aatgtctttgatggcatcttccggaaccccatcttctgcaccatcgtgctgggcaccttt
gccatccagatagtgatcgtgcagtttggggggaagccgttcagctgctctccactgcag
ctggaccagtggatgtggtgcatattcatcgggttaggagagcttgtctggggccaggtc
atcgccaccatcccaaccagcaggctcaagttcctcaaggaggcgggcaggctcacgcag
aaggaggagattcccgaggaggagctcaacgaggacgtggaggagatagaccacgccgag
cgagagctgcggcggggccagatcctatggttccgaggcctgaatcggatccagacccag
atccgcgtcgtgaaggcgttccgtagctctctctacgaaggtctagaaaagcctgagtct
cgaacctccatccataacttcatggctcatcctgaattccggatcgaagattcacagccc
cacatccccctcatcgacgacaccgacctggaagaagatgccgcgctcaagcagaactcg
agcccgccgtcatcgctcaacaaaaacaacagcgccatcgacagtgggatcaacctgacg
accgacacgagcaaatcagctacctcttcaagtccagggagccccatccacagcctggag
acgtcgctttag

KEGG   Miniopterus natalensis: 107538560
Entry
107538560         CDS       T05883                                 

Gene name
ATP2B4
Definition
(RefSeq) plasma membrane calcium-transporting ATPase 4 isoform X1
  KO
K05850  P-type Ca2+ transporter type 2B [EC:7.2.2.10]
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04925  Aldosterone synthesis and secretion
mna04961  Endocrine and other factor-regulated calcium reabsorption
mna04970  Salivary secretion
mna04972  Pancreatic secretion
mna04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107538560 (ATP2B4)
   04024 cAMP signaling pathway
    107538560 (ATP2B4)
   04022 cGMP-PKG signaling pathway
    107538560 (ATP2B4)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    107538560 (ATP2B4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107538560 (ATP2B4)
  09154 Digestive system
   04970 Salivary secretion
    107538560 (ATP2B4)
   04972 Pancreatic secretion
    107538560 (ATP2B4)
   04978 Mineral absorption
    107538560 (ATP2B4)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    107538560 (ATP2B4)
Enzymes [BR:mna01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     107538560 (ATP2B4)
SSDB
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase ATP_Ca_trans_C Cation_ATPase Cation_ATPase_N Hydrolase Hydrolase_3
Other DBs
NCBI-GeneID: 107538560
NCBI-ProteinID: XP_016070335
LinkDB
Position
Unknown
AA seq 1207 aa
MTNPTEHALPANSVEGHEGDFGCSVMDLRKLMELRSADAINHISASYGGVMNLCSRLKTN
PVEGLSGNPADLEKRKQVFGQNLIPPKKPKTFLELVWEALQDVTLIILEIAAIISLVLSF
YRPPGEENEQCGLPVNSPEDEGESEAGWIEGAAILFSVIIVVLVTAFNDWSKEKQFRGLQ
NRIEKEQKFSVIRNGHIIQLPVAEIVVGDIAQIKYGDLLPADGILIQGNDLKIDESSLTG
ESDHVKKSLERDPMLLSGTHVMEGSGRMVVTAVGINSQTGIIFTLLGASEGEEEEKKKKG
KKQGVPENRNKAKTQDGVALEIQPLNSQEGVDSEEKEKKTVKVPKKEKSVLQGKLTRLAV
QIGKAGLIMSAITVLILILYFVIDNFVIQRKQWLAECTPIYIQYFVKFFIIGITVLVVAV
PEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAY
IGDTHYHQLPSPDAFVPKVLDLIVNGISINSAYTSKILPPEKEGGLPRQVGNKTECALLG
FVTDLKQDYHAVRSEVPEEKLYKVYTFNSVRKSMSTVIQKPSGGYRMYSKGASEIILRKC
NRILDKKGEAMPFKNKDRDEMVRTVIEPMASEGLRTICLAYRDFSDVEPPWDNESEILTE
LTCIAVVGIEDPVRPEVPDAIAKCKRAGITVRMVTGDNINTARAIATKCGIVTPGDDFLC
LEGKEFNRLIRNEKGEVEQEKLDKVWPKLRVLARSSPTDKHTLVKGIIDSTVGEQRQVVA
VTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIS
KFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTDSLLK
RRPYGRNKPLISRTMMKNILGHAVYQLTVIFLLVFAGEKLFDIDSGRKAPLHSPPSQHYT
IIFNTFVLMQLFNEINSRKIHGERNVFAGIFRNLIFCSVVLGTFVSQIIIVEFGGKPFSC
TKLTLSQWFWCLFIGIGELLWGQVISTIPTQSLKFLKEAGHGTAKEEITRDAEGLDEIDH
AEMELRRGQILWFRGLNRIQTQIKVVKAFHSSLHESIQKPKNQNSIHNFMTHPEFAIDEE
VPRTPLLDEQEEENLEKVSKSGTRVLLLDGEVTPCSDRNSSVMVDCNQVHIVASPSDSPP
HSLETSV
NT seq 3624 nt   +upstreamnt  +downstreamnt
atgacaaacccaacagaacatgccttgccggccaactcggttgagggccatgagggggac
tttggctgctcagtaatggacctcaggaagctcatggagctgcgttcggccgatgcaata
aaccacatcagcgccagctatggaggcgtaatgaatctctgcagtagactgaaaaccaac
cctgtggaaggtctctctgggaacccggcagatctggaaaaacgtaaacaagtgtttgga
cagaacttaatccctcccaaaaagcccaagaccttcttagaattagtgtgggaagccctt
caagatgtcacactcatcatcctggagatcgcagccatcatctccctggttctgtccttc
taccgcccccctggtgaagaaaatgaacagtgtggtctacctgtaaatagcccagaggac
gaaggggagtcagaagccggctggatcgagggggcggccattctattctcggtgatcatc
gtggtgctagtgacggccttcaatgactggagcaaagagaagcagttccgagggctgcag
aaccgcattgaaaaggagcagaaattctctgttattcggaatggtcacatcatccagctc
cctgtggctgaaatcgtggtgggcgatattgcccaaatcaaatacggtgacctgctgcct
gcagatgggatcctgatccaggggaatgatctaaagattgatgagagctctctgactggg
gaatcagaccatgtcaagaagtccttggaaagagaccccatgttgctctcagggacccac
gtcatggaaggttctggccggatggtggtgactgccgtgggtatcaactcccaaactggg
atcatctttaccctcttgggggccagcgagggagaggaggaggagaagaagaagaaaggt
aaaaaacaaggagtccccgaaaatcgcaacaaagcaaagacccaggatggagtggccctg
gaaatccagccgctcaacagccaggagggtgtcgacagtgaggaaaaggagaagaagaca
gtcaaggtgcccaagaaggagaagtcggtgctgcagggcaagctgacgcgcttggccgtc
cagatcgggaaggctggtctgatcatgtctgctatcaccgttctgatcctgattctctac
tttgtgattgacaacttcgtgatacagcgcaaacagtggctagccgagtgcacgcccatc
tacatccagtactttgtcaagttcttcatcatcggcatcactgtactggtggtggctgtg
ccggaggggctgccactggctgtcaccatttcactggcctactctgtgaagaaaatgatg
aaagacaacaacctggtacggcacctggatgcctgtgagacaatgggcaatgccacagcc
atttgctctgacaagacaggcacgctgaccatgaaccgcatgactgtggtgcaagcttat
attggagatacccattaccatcagctcccaagccctgacgccttcgtgcccaaggtcctg
gaccttattgtcaatggcatttctatcaacagtgcctatacctccaagatcctgcctccg
gagaaggagggcggcctgccccggcaggtgggcaacaagacggagtgtgcgctgctgggc
ttcgtcacagacctgaagcaggactaccacgcggtgcgcagcgaggtgcccgaggagaag
ctctacaaggtgtacaccttcaactcggtgcgcaagtccatgagcacggtcatccagaag
cccagcggcggctaccgcatgtacagcaagggcgcctcggagatcatcttgcgaaagtgt
aatcgaatcctggacaagaaaggagaagccatgccattcaaaaataaggaccgggatgag
atggtgcgcacggtcatcgagcccatggccagtgagggactccggaccatctgcctagct
taccgagatttcagtgatgtagagcccccatgggacaatgagagcgaaatcctcactgaa
ctgacctgcatcgcagtggtgggcattgaggaccctgtgcgcccggaggtaccagatgct
attgccaaatgcaaacgagctggcattactgtcagaatggtgacaggagacaacatcaac
acagcccgggccattgccaccaaatgtggcattgtgacacctggggatgatttcctgtgc
ttggaaggcaaggaatttaaccgactcatccgcaatgagaagggcgaggtagaacaagaa
aagctggacaaggtctggcctaagcttcgagtcctggcgcgatcttcccccacggacaag
catacgctggtgaaaggcattattgacagcactgtcggggaacagcgacaggtggtggct
gtcactggtgatggcacaaatgatgggccggctctgaagaaagcagatgtggggttcgcc
atgggcattgcaggcacagatgtggcaaaggaggcatcagacatcatcctaacagatgac
aacttcaccagcatcgtgaaggcagtgatgtggggacgaaacgtctatgatagtatctcc
aagttcctgcagttccagctcactgtcaatgtggtggccgtgattgtggccttcactgga
gcctgcatcactcaggattccccattgaaagctgtgcagatgctgtgggttaatctaatc
atggacacgtttgcctcactggccctggccacagagcctcccacagattctttgctgaag
cgtcgcccctatggccgaaacaagcccctgatctcccggactatgatgaagaacatcttg
ggccatgctgtctatcagctcacagtcatctttctccttgtctttgccggtgagaaattg
tttgacattgatagtgggaggaaggcacctctacattccccacccagccagcactacacc
attattttcaacacttttgtgctgatgcagctcttcaatgaaatcaactcacgcaagatc
cacggagagaggaatgtctttgcaggcatcttccgtaatctcatcttttgttctgtggtt
ttgggcacattcgtcagccagattatcatcgtggagtttgggggtaagcctttcagttgt
acgaagctcaccctgtcccagtggttttggtgtctcttcattggcattggagaactgctg
tggggtcaggtaatctccacaatacctacccaatccctgaagttcctgaaggaggctggg
catggcactgccaaagaggagatcaccagggatgcagaggggctagacgagattgaccat
gcagaaatggagctgcgccgaggccagatcctctggttccggggcctgaaccgtatccag
actcagatcaaagtggtcaaagcattccatagttccctccatgaaagcatccagaaaccc
aagaaccaaaactccatccacaacttcatgacccaccctgaattcgccatagatgaggag
gtgccacgaacaccactcctggatgagcaagaggaggaaaatcttgaaaaggtttctaag
tctgggactagggtgctcctgttggatggtgaggtcactccatgctccgacagaaacagc
tctgtgatggtggattgcaaccaggtgcatattgttgcctccccttcggacagccctcca
cacagcctggagacatccgtttga

KEGG   Miniopterus natalensis: 107538818
Entry
107538818         CDS       T05883                                 

Gene name
ATP2B3
Definition
(RefSeq) plasma membrane calcium-transporting ATPase 3 isoform X1
  KO
K05850  P-type Ca2+ transporter type 2B [EC:7.2.2.10]
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04925  Aldosterone synthesis and secretion
mna04961  Endocrine and other factor-regulated calcium reabsorption
mna04970  Salivary secretion
mna04972  Pancreatic secretion
mna04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107538818 (ATP2B3)
   04024 cAMP signaling pathway
    107538818 (ATP2B3)
   04022 cGMP-PKG signaling pathway
    107538818 (ATP2B3)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    107538818 (ATP2B3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107538818 (ATP2B3)
  09154 Digestive system
   04970 Salivary secretion
    107538818 (ATP2B3)
   04972 Pancreatic secretion
    107538818 (ATP2B3)
   04978 Mineral absorption
    107538818 (ATP2B3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    107538818 (ATP2B3)
Enzymes [BR:mna01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     107538818 (ATP2B3)
SSDB
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase ATP_Ca_trans_C Cation_ATPase Cation_ATPase_N Hydrolase Hydrolase_3
Other DBs
NCBI-GeneID: 107538818
NCBI-ProteinID: XP_016070636
LinkDB
Position
Unknown
AA seq 1255 aa
MGDMANSSIEFHPKSQQQQEAPHAGGFGCTLTELRSLMELRGAEALQKVQEAYGDVSGLC
RRLKTSPTEGLADNANDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIV
SLGLSFYAPPGEESEACGNVSAGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEK
QFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQGNDLKID
ESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEQE
KKDKKGKAAQTSGKQQDGAMESSQTKAKKQDGAVAMEMQPLKSAEGGEMEEREKKKANVP
KKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIKTFVVGGRVWLAECTPVYVQY
FVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMRDNNLVRHLDACETMGNATAICSD
KTGTLTTNRMTVVQSYLGDTHYKEIPAPSALTPKILDLLVHAISINSAYTTKILPPEKEG
ALPRQVGNKTECALLGFVLDLKRDFQPVREQIPEDKLYKVYTFNSVRKSMSTVIRMQDGG
FRLFSKGASEILLKKCTNILNSNGELRNFRPRDRDDMVKKIIEPMACDGLRTICIAYRDF
SATQEPDWENENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTAR
AIAAKCGIIQPGEDFLCLEGKEFNRRIRNEKGEIEQERLDKVWPKLRVLARSSPTDKHTL
VKGIIDSTTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFT
SIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDT
FASLALATEPPTESLLLRKPYGRDKPLISRTMMKNILGHAVYQLTVIFTLLFIGELFFDI
DSGRNAPLHAPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFHGIFGNPIFCTIVLGT
FAIQIVIVQFGGKPFSCSPLSTEQWLWCLFVGVGELVWGQVIATIPTSQLKCLKEAGHGP
GKDEMTDEELAEGEEEIDHAERELRRGQILWFRGLNRIQTQMEVVSTFKRSGSFQGAVRR
RSSVLSQLHDIRVVKAFRSSLYEGLEKPESKTSIHNFMATPEFLINDYTHNIPLIDDTDV
DETEERLRAPPPPPNQNNNAIDSGVCLATRGTKLATSPVFSSGPGSLLHSVETSL
NT seq 3768 nt   +upstreamnt  +downstreamnt
atgggtgacatggccaacagttccatcgagttccaccccaagtcccagcagcagcaagag
gccccacatgcaggcggctttgggtgcacgctgactgaactgcgctccctcatggagctc
cgaggggctgaggcgctgcagaaggtccaagaagcctatggagatgtcagcgggctctgc
aggaggctgaagacctcgcccacagaaggcctggcggacaacgccaatgacttggagaag
cgcaggcagatctatgggcagaacttcattcctcccaagcagcccaagaccttcctgcag
ctggtgtgggaggccttgcaggacgtgaccctcatcatcctggaggtggccgctatcgtc
tccctgggcctctccttctacgcaccacctggagaggagagcgaagcgtgcgggaatgtg
tcagctggggcagaagatgaaggggaggccgaggctggctggatcgagggggcagccatc
ttgctgtctgtcatctgtgtggtgctggtcacggccttcaatgactggagcaaggagaag
cagttccgaggccttcagagtcgtatagagcaggaacagaagttcacagtcatccggaat
ggacagctcctccaggtccctgtggcggcgctggtggtgggggacatcgcccaggtcaag
tatggagaccttctgcctgccgatggcgtgctcatccagggcaacgacctcaaaatcgac
gagagctccctgactggagagtcagaccacgtgcgcaagtcagccgacaaagaccccatg
ctgctctcaggcactcatgtcatggaaggctctggaagaatggtggtgacagctgtgggt
gtgaactcccagacaggcatcatctttaccttgcttggggctggcggagaggagcaggag
aagaaggataagaaaggtaaggccgcacagacctcaggcaagcagcaggatggggcgatg
gagagtagccagaccaaagctaagaagcaggatggggcagttgccatggaaatgcagccc
ctgaagagtgcagagggcggggaaatggaggagcgggagaagaagaaagccaacgtgccc
aagaaggagaagtcggtcctgcagggcaagctcaccaaactggctgtgcagatcgggaaa
gcagggctggtgatgtccgccatcaccgtcattatcctggtcctctacttcgtgatcaag
accttcgtcgtgggtggccgggtgtggctggcagagtgcacaccagtctatgtgcagtac
ttcgtgaagttcttcatcatcggtgtcactgtgctggtggtggctgtcccggagggccta
cctcttgctgtcaccatctctttagcttactctgtcaagaaaatgatgagggacaacaac
ctggtccgacacctggacgcctgtgagacaatgggcaacgccacagccatctgctcagac
aagacgggcacactcaccaccaaccgtatgaccgtggtccagtcctacctcggggacacc
cactacaaagagattccggcccccagcgccctgacccccaagatcctcgacctcttggtc
cacgccatctccatcaacagtgcctacaccaccaaaatactacctccagagaaggaaggt
gccctcccgcgccaagtgggcaacaagacagaatgcgctctgctgggcttcgtcctggac
ctgaagcgggacttccagcctgtgcgggaacagattccggaagataagctttacaaagta
tacaccttcaactcagtccgaaagtccatgagcacggtcatccgcatgcaggatggtggc
ttccgcctgttcagcaagggtgcctcagagatcctgctgaaaaagtgcaccaacatctta
aatagcaatggggaactgcggaacttccgccctcgggaccgggatgacatggtgaagaag
atcatcgagccgatggcctgcgacggcctccgcaccatctgcatcgcctaccgggacttc
tctgccacccaggagcctgactgggaaaatgagaatgaagttgtgggcgacctcacctgc
atagccgtcgtaggcatcgaggaccccgtgaggccagaggtccctgaagctatccgcaaa
tgccagcgtgctggcattacagtccgaatggtgaccggggacaacatcaatacagcccgg
gccattgcagcaaaatgtggcatcatccagcctggggaggacttcctgtgcctggaaggg
aaggagttcaaccggaggatccgcaatgagaaaggcgagatagaacaagaacgactggac
aaagtgtggcctaagctgagggtcctcgcccgatcatctcccacagacaagcacactctt
gtcaaagggatcattgacagcactactggtgagcagcgacaggtggtggctgtgaccggg
gatggcaccaacgatggcccagccctcaagaaggcagacgtgggcttcgccatgggcatc
gcaggaactgacgtggccaaggaggcctcagacattatcctgaccgatgacaatttcacc
agtatcgtcaaggcagtcatgtggggccgcaacgtctacgatagcatctccaagttcctg
caattccagctgacggtcaacgtggtggccgtgatcgtggccttcacgggtgcctgcatt
actcaggactctcctctcaaagccgtgcagatgttgtgggtgaacttgattatggacaca
tttgcctctctggccctggcaacagagccgcccactgagtcactgctgctgcggaagccg
tatggtcgggacaagcctctgatctcccggaccatgatgaagaacatcctgggccatgcg
gtctaccagctcaccgtcatcttcacgctgctcttcattggggagcttttcttcgacatc
gacagtgggaggaacgcaccgctgcacgcgccaccctcggagcactacaccatcatcttc
aacaccttcgtcatgatgcagctcttcaacgagatcaacgcccgcaagatccacggcgag
cgcaacgtcttccacggcatctttggcaaccccatcttctgcaccatcgtcctgggcacc
tttgcaattcagattgtcatcgtccagtttggtggaaagcccttcagctgctcccctctg
tccacggagcagtggctctggtgcctgtttgttggtgttggggagctggtctggggacag
gtcatagccaccattcccaccagccagctcaagtgcctgaaggaagcagggcacgggcct
gggaaggatgagatgactgacgaggagctagcagagggggaagaagagattgaccacgcc
gagcgggagctccgcagaggccagatcctctggttccggggcctcaaccggatccagacg
cagatggaggtagtgagtaccttcaagagaagcggttcatttcagggtgccgtgcgccgg
cggtcttcggtcctcagccagctccatgacatccgagtggtgaaagcattccgtagctcg
ctctatgaaggcctggagaaaccggaatccaagacttccatccataacttcatggcaacg
cccgaatttctgatcaacgactacacccacaacatcccgctcatagatgacacggacgtg
gacgagaccgaggagcgcctgcgggcgccgcccccaccccccaaccagaacaacaacgcc
atagacagcggcgtctgcctggccacgcgggggaccaagttggctacctcgccagtgttc
tcttccgggcctgggagtctgctccacagcgtggagacgtccctctga

KEGG   Miniopterus natalensis: 107538895
Entry
107538895         CDS       T05883                                 

Gene name
ATP2B1
Definition
(RefSeq) plasma membrane calcium-transporting ATPase 1
  KO
K05850  P-type Ca2+ transporter type 2B [EC:7.2.2.10]
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04925  Aldosterone synthesis and secretion
mna04961  Endocrine and other factor-regulated calcium reabsorption
mna04970  Salivary secretion
mna04972  Pancreatic secretion
mna04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107538895 (ATP2B1)
   04024 cAMP signaling pathway
    107538895 (ATP2B1)
   04022 cGMP-PKG signaling pathway
    107538895 (ATP2B1)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    107538895 (ATP2B1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107538895 (ATP2B1)
  09154 Digestive system
   04970 Salivary secretion
    107538895 (ATP2B1)
   04972 Pancreatic secretion
    107538895 (ATP2B1)
   04978 Mineral absorption
    107538895 (ATP2B1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    107538895 (ATP2B1)
Enzymes [BR:mna01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     107538895 (ATP2B1)
SSDB
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase ATP_Ca_trans_C Cation_ATPase Cation_ATPase_N Hydrolase Hydrolase_3 DUF2201_N
Other DBs
NCBI-GeneID: 107538895
NCBI-ProteinID: XP_016070712
LinkDB
Position
Unknown
AA seq 1258 aa
MGDMANNSVSYTGVKNSLKEANYDGDFGTTLSELRSLMELRSTDALRKIQESYGDVYGIC
TRLKTSPNEGLSGNPADIERREAVFGRNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIV
SLGLSFYQPPEGDNALCGEVSVGEEEGEGETGWIEGAAILLSVVCVVLVTAFNDWSKEKQ
FRGLQSRIEQEQKFTVIRGGQVIQIPVADIIVGDIAQVKYGDLLPADGILIQGNDLKIDE
SSLTGESDHVRKSLDKDPLLLSGTHVMEGSGRMVVTAVGINSQTGIIFTLLGAGGEEEEK
KDEKKKEKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEDGGDGDEKDKKKANLPKKEKS
VLQGKLTKLAVQIGKAGLLMSAITVIILVLYFVIDTFWVQKRPWLAECTPIYIQYFVKFF
IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTL
TMNRMTVVQAYINEKHYKKVPEPEAIPPNILSYLVTGISVNCAYTSKILPPEKEGGLPRH
VGNKTECALLGFLLDLKRDYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSYRIFS
KGASEIILKKCFKILSANGEAKVFRPRDRDDIIKTVIEPMASEGLRTICLAFRDFPAGEA
EPEWDNENDIVTGLTCIAVVGIEDPVRPEVPDAIKKCQRAGITVRMVTGDNINTARAIAS
KCGILHPGEDFLCIEGKDFNRRIRNEKGEIEQERIDKIWPKLRVLARSSPTDKHTLVKGI
IDSTVSEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVK
AVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTLASL
ALATEPPTESLLLRKPYGRNKPLISRTMMKNILGHAFYQLVVVFTLLFAGEKFFDIDSGR
NAPLHAPPSEHYTIVFNTFVLMQLFNEINARKIHGERNVFEGIFNNIIFCSIVLGTFVVQ
IIIVQFGGKPFSCSELSVEQWLWSVFLGMGTLLWGQLISTIPTSRLKFLKEAGHGTQKEE
IPEEELAEDVEEIDHAERELRRGQILWFRGLNRIQTQMDVVNAFQSGSTIQGALRRQPSI
ASQHHDVTNISTPTHIRVVNAFRSSLYEGLEKPESRSSIHNFMTHPEFRIEDSEPHIPLI
DDTDAEDDAPTKRNSSPPPSPNKNNNAVDSGIYLTIEMNKSATSSSPGSPLHSLETSL
NT seq 3777 nt   +upstreamnt  +downstreamnt
atgggcgacatggcaaacaactctgtttcatatactggagtaaaaaactctttgaaggaa
gctaattatgatggagactttggaactacgctctcagaactgcggtctctcatggagctc
aggtctacagatgctttacgaaaaatacaggaaagctatggagatgtctatggaatttgt
accaggttgaaaacatctcccaatgaaggtttaagtggaaaccctgcagatatagaaaga
agagaagcagtgtttggaaggaattttatacctcctaaaaagccaaaaacctttcttcag
ttagtatgggaagcattacaagatgtcactttaattatattagaaattgcagccatagta
tcactgggcctttctttttatcaacctccagaaggggataatgcactttgtggagaagtt
tctgttggagaggaagaaggtgaaggtgaaactggttggattgaaggagctgcaatcctc
ttgtcagtagtatgtgtggtattagtgacagctttcaatgactggagtaaggagaaacag
ttcagaggcttgcagagtcgaattgaacaagaacagaagttcacagtcatcaggggtggt
caggtcattcagatacctgtagccgacattattgttggagatatcgctcaagtaaaatat
ggggatctccttccagctgatggcatacttattcaaggcaatgatcttaaaattgatgaa
agctctttgactggggaatctgatcatgttaggaaatctttagataaggatcccttactt
ctatcaggtactcatgtaatggaaggctctggaagaatggtagttactgccgtaggtatc
aattctcaaactggaattatctttaccttacttggagctggaggcgaagaagaagagaag
aaagatgagaagaaaaaggaaaagaaaaataagaaacaagatggagctattgagaatcgc
aacaaagcaaaagcccaggatggtgcagccatggaaatgcagcccttgaagagtgaagat
ggtggcgatggtgatgaaaaagacaaaaagaaagcaaatttgccaaaaaaggaaaaatct
gttttacaaggaaaacttacaaagctggctgttcagattggcaaagcaggtttgttgatg
tctgccatcacagttatcattctagtattatattttgtaattgatacattctgggttcag
aagagaccgtggcttgccgagtgcacaccgatttacatacaatattttgtgaagttcttc
attattggagttacggttttagtggttgccgtgccagaaggtcttccacttgcagtgact
atctcactggcttactcggtcaagaaaatgatgaaagataataacttagtaaggcatctg
gatgcttgtgaaaccatgggaaatgccacagccatttgctcagataaaacaggaacattg
acaatgaacagaatgacagttgttcaagcttacataaatgaaaaacattataaaaaggtc
cctgaaccagaagctattccaccaaatatcttgtcctatcttgtaacaggaatttctgtg
aattgtgcttatacatcaaaaatactgccaccagagaaagagggtggattacctcgtcat
gttggtaataaaactgaatgtgccttgttgggatttcttttggatttaaaacgggattat
caggatgttagaaatgaaataccagaagaagcactgtacaaagtctacaccttcaattct
gttaggaagtccatgagtactgtcctaaaaaattcagatggaagttatcgaatattcagc
aagggtgcatctgagataattctgaaaaagtgtttcaaaatcttgagtgctaatggtgag
gcaaaagtgttccgaccaagggaccgtgatgatattataaaaaccgtgattgagccgatg
gcgtcagaaggcttgagaaccatatgtcttgcgttcagagatttcccagccggagaagca
gaaccagagtgggataatgagaacgatattgtcaccgggctcacgtgcattgctgtcgtg
gggattgaagacccagtgagacccgaggtaccagatgcaataaagaaatgtcagagagct
ggaattactgtgcggatggtcactggtgataatattaatacagctcgggctattgccagc
aaatgtggtattttacatcctggggaagatttcctatgtatagaaggtaaagatttcaac
agaagaatacgaaatgaaaaaggagagattgagcaagagcggatagacaagatttggcca
aagcttcgagtacttgcaagatcatctcctactgacaaacatacactggttaaaggtata
atcgacagcactgtctcagaacaacgtcaggttgtagcagtaactggtgatggtacaaat
gatggtccagcactgaagaaagcggatgttggatttgcaatgggcatcgctggaactgat
gtggctaaagaagcgtctgatatcattctcacagatgacaactttacaagcattgttaaa
gcagttatgtggggacgaaatgtctatgacagcatctcaaaattccttcagttccagctc
actgttaatgtcgtagcagtgattgttgctttcacaggcgcctgtattactcaagactcg
ccgcttaaggctgtgcagatgctgtgggttaacctcatcatggacacgctcgcctccctg
gctctggcaaccgagccccccacggagtccctcctgcttcggaaaccttatggtagaaat
aaacctctcatctcacgcacgatgatgaagaacattttgggtcatgcattctatcaactt
gtagtagtctttacgctcttgtttgctggagaaaagttttttgatattgatagtggaaga
aacgctcctctgcatgctcctccttcggaacattacactattgtttttaatacatttgtg
ctgatgcaacttttcaacgaaataaatgcccggaaaattcatggtgaaagaaatgtgttt
gaaggaatctttaataatatcatcttctgctcaattgttttaggcacttttgtggtacag
ataataattgtgcaatttggtggaaagcctttcagttgttcagaactttcggtagaacag
tggctatggtcagtattcctaggaatgggaacgttactctggggccagcttatttcaaca
attccaactagccgtttaaaattcctaaaagaagctggtcatggaacacaaaaggaagaa
atacctgaggaagagttagcagaggacgtggaagagatcgatcacgccgaaagggagttg
cggcgtggccagatcttgtggtttagaggtctgaacagaatccagacgcagatggatgta
gtgaatgctttccagagtggaagtaccattcagggggctctaaggcggcaaccctccatc
gccagccagcatcatgatgtaacaaatatttctacccctacacatattcgagtggtgaat
gcatttcgtagttctttatatgaagggttagaaaaaccggaatcaagaagttcgattcac
aactttatgacacatcctgagtttaggatagaagattcagagcctcatatcccccttatt
gatgacactgatgctgaagacgatgctcctacaaaacgtaactccagtcctccaccctct
cccaacaaaaataacaatgctgttgacagcgggatttaccttacaatagaaatgaacaag
tctgctacctcttcatccccaggaagcccactacatagtttggaaacatcactctga

DBGET integrated database retrieval system