KEGG   Miniopterus natalensis: 107534771
Entry
107534771         CDS       T05883                                 

Gene name
GHRL
Definition
(RefSeq) appetite-regulating hormone
  KO
K05254  ghrelin
Organism
mna  Miniopterus natalensis
Pathway
mna04024  cAMP signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107534771 (GHRL)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107534771 (GHRL)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    107534771 (GHRL)
SSDB
Motif
Pfam: Motilin_assoc Motilin_ghrelin
Other DBs
NCBI-GeneID: 107534771
NCBI-ProteinID: XP_016065461
LinkDB
Position
Unknown
AA seq 192 aa
MGRQAELLPCPLGSYLSSEAWGEEGRGRAGDGKRGKDMLTGDPLSSRPICLNPTKAMPSP
GTICCLLLLSVLWVDLAMAGSSFLSPEHQKVQQRKESKKPPAKLQPQPRELKGWLRPEDG
NQAEGAEDELEIRFNTPFDVGIKLSGAQSHRHGQALGKFLQDMFWEEANGKSLPKSGQFS
FLRVPNVSPHYG
NT seq 579 nt   +upstreamnt  +downstreamnt
atggggaggcaggcagagctgctaccctgtccgctaggctcctacctgagttctgaggcc
tggggagaggaagggagaggaagggcaggggacggaaagagaggaaaggacatgctaact
ggagaccctctctcctctaggcccatctgtctcaacccaaccaaggccatgccctcccca
gggaccatctgctgcctgctgctcctcagtgtgctctgggtggacttggccatggcaggc
tccagcttcctgagccccgaacaccagaaagtgcagcagagaaaggagtccaagaagcca
ccagccaagctgcagccccagccccgggagctcaaaggctggctccgcccagaagatgga
aatcaggcagaaggggcagaggatgagctggaaattcggttcaacaccccctttgatgtt
ggaatcaagctgtcaggggctcagtcccaccggcatggccaagccctggggaagtttctt
caggacatgttttgggaagaggccaatggtaagtccctccctaaatcaggtcaattcagt
ttcctcagagtcccaaatgtcagtccacattatgggtga

DBGET integrated database retrieval system