KEGG   Miniopterus natalensis: 107534793
Entry
107534793         CDS       T05883                                 

Gene name
KCNK3
Definition
(RefSeq) potassium channel subfamily K member 3
  KO
K04914  potassium channel subfamily K member 3
Organism
mna  Miniopterus natalensis
Pathway
mna04925  Aldosterone synthesis and secretion
mna04927  Cortisol synthesis and secretion
mna04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    107534793 (KCNK3)
   04927 Cortisol synthesis and secretion
    107534793 (KCNK3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107534793 (KCNK3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107534793 (KCNK3)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Potassium channel, two-pore domain (K2P)
   107534793 (KCNK3)
SSDB
Motif
Pfam: Ion_trans_2 Ion_trans IRK
Other DBs
NCBI-GeneID: 107534793
NCBI-ProteinID: XP_016065505
LinkDB
Position
Unknown
AA seq 311 aa
NLSQGGYEELERVVLRLKPHKAGVQWRFAGSFYFAITVITTIGYGHAAPSTDGGKVFCMF
YALLGIPLTLVMFQSLGERINTFVKFLLHRAKRGLGMRRADVSMANMVLIGFFSCISTLC
IGAAAFSYYEHWTFFQAYYYCFITLTTIGFGDYVALQKDQALQTQPQYVAFSFVYILTGL
TVIGAFLNLVVLRFMTMNAEDEKRDAEHRALLTRNVYAEVLHFQSMCSCLWYKSREKLQY
SIPMIIPRDLSTSDTCVEQSHSSPGGGGRYSDTPSHRCLCGGAQRSAISSVSTGLHSLSA
FRGLMKRRSSV
NT seq 936 nt   +upstreamnt  +downstreamnt
aacctcagccagggcggctacgaggagctcgagcgcgtcgtgctgcgcctcaagccgcac
aaggccggcgtgcagtggcgcttcgccggctccttctacttcgccatcaccgtcatcacc
accatcggctacgggcacgcggcgcccagcacggatggcggcaaggtgttctgcatgttc
tacgcgctgctgggcatcccgctcacgctggtcatgttccagagcctgggcgagcgcatc
aacaccttcgtgaagttcctgctgcaccgcgccaagcggggcctgggcatgcggcgcgcc
gacgtgtccatggccaacatggtgctcatcggcttcttctcgtgcatcagcacgctgtgc
atcggcgccgccgccttctcctactacgagcactggaccttcttccaggcctactactac
tgcttcatcacgctcaccaccatcggcttcggcgactacgtggcgctgcagaaggaccag
gcgctgcagacgcagccgcagtacgtggccttcagcttcgtgtacatcctcacgggcctc
acggtcatcggcgccttcctcaacctcgtggtgctgcgcttcatgaccatgaacgccgag
gacgagaagcgcgacgccgagcaccgcgcgctgctcacgcgcaacgtctacgccgaggtg
ctgcacttccagtccatgtgctcgtgcctctggtacaagagccgcgagaagctgcagtac
tccatccccatgatcatcccgcgggacctctccacgtccgacacgtgcgtggagcagagc
cactcgtcgccgggcgggggcggccgctacagtgacacgccctcgcaccgctgtctgtgc
ggcggcgcgcagcgctcggccatcagctccgtgtccaccggcctgcacagcctgtccgcc
ttccgcggcctcatgaagcgcaggagctccgtgtga

DBGET integrated database retrieval system