KEGG   Miniopterus natalensis: 107534931
Entry
107534931         CDS       T05883                                 

Gene name
CACNA1D
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1D isoform X1
  KO
K04851  voltage-dependent calcium channel L type alpha-1D
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04218  Cellular senescence
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04270  Vascular smooth muscle contraction
mna04530  Tight junction
mna04713  Circadian entrainment
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04911  Insulin secretion
mna04912  GnRH signaling pathway
mna04921  Oxytocin signaling pathway
mna04924  Renin secretion
mna04925  Aldosterone synthesis and secretion
mna04927  Cortisol synthesis and secretion
mna04929  GnRH secretion
mna04930  Type II diabetes mellitus
mna04934  Cushing syndrome
mna04935  Growth hormone synthesis, secretion and action
mna04973  Carbohydrate digestion and absorption
mna05010  Alzheimer disease
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05031  Amphetamine addiction
mna05410  Hypertrophic cardiomyopathy
mna05412  Arrhythmogenic right ventricular cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107534931 (CACNA1D)
   04020 Calcium signaling pathway
    107534931 (CACNA1D)
   04024 cAMP signaling pathway
    107534931 (CACNA1D)
   04022 cGMP-PKG signaling pathway
    107534931 (CACNA1D)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107534931 (CACNA1D)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107534931 (CACNA1D)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107534931 (CACNA1D)
   04929 GnRH secretion
    107534931 (CACNA1D)
   04912 GnRH signaling pathway
    107534931 (CACNA1D)
   04921 Oxytocin signaling pathway
    107534931 (CACNA1D)
   04935 Growth hormone synthesis, secretion and action
    107534931 (CACNA1D)
   04924 Renin secretion
    107534931 (CACNA1D)
   04925 Aldosterone synthesis and secretion
    107534931 (CACNA1D)
   04927 Cortisol synthesis and secretion
    107534931 (CACNA1D)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107534931 (CACNA1D)
   04261 Adrenergic signaling in cardiomyocytes
    107534931 (CACNA1D)
   04270 Vascular smooth muscle contraction
    107534931 (CACNA1D)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    107534931 (CACNA1D)
  09156 Nervous system
   04724 Glutamatergic synapse
    107534931 (CACNA1D)
   04727 GABAergic synapse
    107534931 (CACNA1D)
   04725 Cholinergic synapse
    107534931 (CACNA1D)
   04728 Dopaminergic synapse
    107534931 (CACNA1D)
   04726 Serotonergic synapse
    107534931 (CACNA1D)
   04723 Retrograde endocannabinoid signaling
    107534931 (CACNA1D)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107534931 (CACNA1D)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107534931 (CACNA1D)
   05020 Prion disease
    107534931 (CACNA1D)
   05022 Pathways of neurodegeneration - multiple diseases
    107534931 (CACNA1D)
  09165 Substance dependence
   05031 Amphetamine addiction
    107534931 (CACNA1D)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107534931 (CACNA1D)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107534931 (CACNA1D)
   05414 Dilated cardiomyopathy
    107534931 (CACNA1D)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107534931 (CACNA1D)
   04934 Cushing syndrome
    107534931 (CACNA1D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107534931 (CACNA1D)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107534931 (CACNA1D)
SSDB
Motif
Pfam: Ion_trans CAC1F_C Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 107534931
NCBI-ProteinID: XP_016065693
LinkDB
Position
Unknown
AA seq 2089 aa
MSTSAPPPVGSLSQRKRQQYAKSKKQGNSSNSRPARALFCLSLNNPIRRACISIVEWKPF
DIFILLAIFANCVALAIYIPFPEDDSNSTNHNLEKVEYAFLIIFTVETFLKIIAYGLLLH
PNAYVRNGWNLLDFVIVIVGLFSVILEQLTKETEGGNHSGGKSGGFDVKALRAFRVLRPL
RLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHKTCFFADSDI
VAEEDPAPCAFSGNGRQCIVNGTECRSGWVGPNGGITNFDNFAFAMLTVFQCITMEGWTD
VLYWMNDAMGFELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREK
QQLEEDLKGYLDWITQAEDIDPENEEEGGEESKRNTSMPTSETESVNTENVSGEGENQGC
WGTLCQAISKSKLSRRWRRWNRFSRRRCRAAVKSVTFYWLVIVLVFLNTLTISSEHYNQP
DWLTQVQDIANKVLLAMFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVELE
IMSPLGISVFRCVRLLRIFKVTRHWTSLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLG
MQLFGGKFNFDETQTKRSTFDNFPQALLTVFQILTGEDWNAVMYDGIMAYGGPSSSGMIV
CIYFIILFICGNYILLNVFLAIAVDNLADAESLNTAQKEEAEEKERKKIARKESLENKKN
KPEVNQMANSDNKVTVDDYQEEEEDKDPYPPCDVPVAEEEEEEEEEEPEVPAGPRPRRIS
ELNMKEKIVPIPEGSAFFILSKTNPIRVGCHKLINHHVFTNLILVFIMLSSASLAAEDPI
RSHSFRNTILGYFDYAFTAIFTVEILLKMTTFGAFLHKGAFCRNYFNLLDMLVVGVSLVS
FGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMF
ACIGVQLFKGKFYRCTDEAKSNPEECRGLFIFYKDGEVDNPVVRERIWQNSDFNFDNVLS
AMMALFTVSTFEGWPDLLYKAIDSHGENVGPIYNYRVEISIFFIIYIIIVAFFMMNIFVG
FVIVTFQEQGEKEYKNCELDKNQRQCVEYALKARPVRRYIPKNPYQYKFWYVVNSSPFEY
MMFVLIMLNTLCLAMQHYEQSKMFNDAMDILNMVFTGVFTVEMVLKVIAFKPKGYFSDAW
NTFDSLIVIGSIIDVALSEADPTESENVPVPTAPPGNSEESNRISITFFRLFRVMRLVKL
LSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQMFGKVAMRDNNQINRNNNF
QTFPQAVLLLFRCATGEAWQEIMLACLPGKLCDPESDYNPGEEYSCGSNFAIVYFISFYM
LCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVTLL
RRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTALKIKTEGNLEQA
NEELRAVIKKIWKKTSMKLLDQVVPPAGDDEVTVGKFYATFLIQDYFRKFKKRKEQGLVG
KYPAKNTTIALQAGLRTLHDIGPEIRRAISCDLQDDEPEETKEEEDVVKRNGALLGNHVN
HVNSDRRDSLQQTNTTHRPLHVQRPSIPPASDTEKPLFPPAGNSVCHNHHNHNSIGKQAP
SSTNANLNNANMSKAAPGKRPSNGNLEHVSENGHDSSHKHDHEPQRRSSIKRARYYETYI
RSDSGDEQFPTICREDPEIQGYFRDPCYLGEPEYFSGEEDYEDSSPTSSRQNYSYYSRHP
GSSVDFERPRGYHHPQDFLEDSDSPVCYDSRRSPRRRLLPPTPTSHRRSSFNFECLRRQS
SQEEFPPSPTFPHRTALPLHLMQQQIMAVAGLDSSKAQKYSPSHSTRSWATPPATPPYQD
WTPCYTPLIQVEQTEALDQVNGSLPSLHRSSWYTDEPGISYRTFTPASLTVPSSFHNKNS
DKQRSADSLVEAVLISEGLGRYARDPKFVCATKHEIADACDLTIDEMESAASNLLNGTVH
PRANGDVGPISGQQDYELQDFGPGYSDEEPDPGREEEDLADEMICITTL
NT seq 6270 nt   +upstreamnt  +downstreamnt
atgagcacctccgcacccccacctgtaggatctctctcccaaagaaaacgtcagcaatac
gccaagagcaaaaaacagggtaactcgtctaacagccgacctgcccgagccctcttctgt
ttatcactcaataaccccatccgaagagcctgcattagtatagtggaatggaaaccattt
gacatatttatattattggctatttttgccaattgtgtggccttagctatttacatccca
tttcctgaagatgattctaattcaacaaatcataacttggaaaaagtagaatatgccttc
ctgattatttttacagtcgagacatttttgaagattatagcgtatggattattgctacat
cctaatgcttatgttaggaatggatggaatttactggattttgttatagtaatagtagga
ttgtttagtgtaattttggaacaattaaccaaagaaacagaaggcggcaaccactctggt
ggcaaatcgggaggctttgatgtcaaagccctccgtgccttccgagtgctacgaccactt
cgactagtatcaggagtgcccagtttacaagttgtcctgaactccattataaaagccatg
gtccccctcctgcacatagcccttttggtgttatttgtaatcataatctatgctattata
ggattggaactttttattggaaaaatgcacaaaacatgtttttttgctgactcagatatc
gtagctgaagaggacccagcgccgtgtgcgttctcagggaatggacgccagtgtatcgtc
aacggcacagagtgtaggagtggctgggttggcccaaacggaggcatcaccaactttgat
aactttgcctttgctatgctcaccgtgtttcagtgcatcaccatggagggctggacagac
gtgctctactggatgaatgatgctatgggatttgaattgccctgggtgtattttgtcagt
ctcgtcatctttgggtcatttttcgtactaaatcttgtacttggtgtattgagcggagaa
ttctccaaggaaagagagaaagcaaaagcccggggagatttccagaaactccgggagaag
cagcagcttgaagaggacctgaagggctacttggattggattacccaagcagaagacatt
gaccctgagaatgaggaggagggaggagaggaaagcaagcgaaacaccagcatgccgacc
agcgagacggaatctgtgaacacggagaacgtaagtggcgaaggcgagaaccaaggctgc
tggggaactctctgtcaagccatctcaaaatccaagctcagccgccgctggcgtcgctgg
aaccgattcagtcgcagaagatgcagggcggccgtgaagtctgtcacgttctactggctg
gttattgtcttggtgtttctcaacaccttaaccatttcctccgagcactacaaccagcct
gactggttgacgcaggttcaagatatcgcgaacaaagtcctcctggctatgttcacctgc
gagatgctggtgaagatgtacagcctgggcctccaggcgtatttcgtctctctctttaac
cggtttgattgtttcgtggtgtgtggtggaattacggaaacgatcttggtggaactggaa
atcatgtctcccctggggatctccgtgtttcgctgtgtgcgcctcttacggattttcaaa
gtgaccaggcactggacatccctgagcaacttggtggcatcgctgttaaactccatgaag
tccatcgcgtcgctgctgcttctgcttttcctcttcatcatcatcttctccttgcttggg
atgcagctgtttggaggcaagtttaacttcgatgagacacagaccaagcggagcaccttc
gacaatttccctcaagcgctgctgacagtgttccagattctgacaggtgaagactggaat
gctgtgatgtatgatggcatcatggcctacgggggcccgtcgtcttcgggcatgatcgtc
tgcatctacttcatcattctcttcatttgcgggaactatattctactgaatgtcttcttg
gccatcgctgtagacaatttggctgatgctgaaagtttgaatactgctcagaaagaggaa
gctgaagaaaaggaaaggaaaaagattgccagaaaagaaagcctggaaaataaaaagaac
aagccggaagtcaaccagatggccaacagtgacaacaaggttacagtcgatgactaccaa
gaagaagaagaagacaaggacccctatccaccttgcgatgtgccagtagctgaagaggaa
gaagaggaggaggaggaggagcctgaggtccctgccgggccccgtcctcgtagaatctca
gagctgaacatgaaagagaagatcgtccccattcctgaagggagcgctttcttcatcctc
agcaagaccaacccgatccgcgtgggctgccacaagctcatcaaccatcatgtcttcacc
aacctcatcctggtcttcatcatgctcagcagcgcgtccctggccgccgaggaccccatc
cgaagccactccttccggaacactatactgggttactttgactatgctttcacagccatc
tttactgttgaaatcctgttaaagatgacgacctttggagctttcctccacaaaggggcc
ttctgcaggaactacttcaacctgctggatatgctggtggtcggggtgtctctggtgtca
tttgggatccaatccagtgccatctccgttgtgaagattctcagggtcttaagggtcctg
aggccgctcagggcaatcaacagagcgaaaggactgaagcacgtcgtccagtgcgtcttt
gtggccatccggacaatcggcaacatcatgatcgtcaccacccttctgcagttcatgttt
gcctgcatcggggtccagttgttcaagggaaagttctatcgctgcacagatgaagccaaa
agtaaccccgaagaatgcagggggcttttcatattctacaaggatggggaggttgataac
cctgtggtccgtgagaggatctggcaaaatagcgatttcaactttgacaatgtcctttcg
gctatgatggcactgttcacggtctccacgtttgagggctggcctgatttgctgtacaaa
gccatcgactcgcacggagagaacgtcggcccgatctacaactaccgcgtagagatctcc
atcttcttcatcatctacatcatcatcgtcgctttcttcatgatgaacatcttcgtgggt
ttcgtcattgtcacattccaggagcagggagaaaaagagtataagaactgtgagctggac
aaaaatcagcgtcagtgtgtggaatacgccttgaaagcgcgccctgtgcggagatacatc
cccaaaaacccctaccagtacaagttctggtatgtggtgaactcctcgccgttcgaatac
atgatgtttgtcctcatcatgctcaacacactctgcttggccatgcagcactacgagcag
tccaagatgtttaatgacgccatggacattctgaacatggtcttcaccggggtgttcact
gtcgagatggttttgaaagtcattgcgtttaaacctaaggggtattttagtgacgcctgg
aatacgtttgactccctcatcgtaatcggcagcattatagacgtggccctcagcgaagct
gacccaactgaaagtgagaatgtccctgtcccaactgctccacctgggaactctgaagag
agcaatagaatctccatcacctttttccgtcttttccgagtgatgcgattggtgaagctt
ctcagcaggggggaaggcatccggaccttgctgtggacttttattaagtcttttcaggcg
ctcccgtatgtcgccctcctcatagccatgctgttcttcatctacgcggttattggcatg
cagatgtttgggaaagttgccatgagagataacaaccagatcaacaggaacaataacttc
cagacctttccccaggcggtgttgctgctcttcaggtgtgcgacaggtgaggcctggcag
gagatcatgctggcctgcctccccggcaagctctgcgaccccgagtcggattacaaccct
ggggaggagtactcgtgtgggagcaactttgccatcgtgtacttcatcagtttttacatg
ctctgcgcatttctgatcatcaacctgtttgtggcggtcatcatggataattttgattat
ctgacccgggactggtctattctgggacctcaccatttagatgaattcaagaggatatgg
tcagaatatgaccctgaggctaagggaaggatcaagcaccttgacgtggtcaccctgctc
cgccgcatccagcctcccctggggtttgggaagttatgcccacacagagtcgcctgtaag
agactagttgccatgaacatgcctctcaacagcgatgggacagtcatgtttaatgcaacc
ctgtttgctttggttcgaacagctctaaaaatcaagacggaagggaacctggaacaagca
aacgaagaactccgagctgtgataaagaaaatctggaagaaaaccagcatgaagctactt
gaccaagttgtccctccagctggtgatgatgaggtaaccgtggggaagttctatgccact
ttcctgatacaggactactttaggaaattcaagaaacggaaagaacaaggactggtggga
aagtaccctgcgaagaacaccacaattgccctacaggcggggttaaggacactgcacgac
atcgggccagagatccggcgggctatatcatgtgatctgcaggacgatgagcctgaggaa
accaaagaggaagaagatgtagtcaaaagaaatggtgccctgcttggaaaccatgtcaat
catgttaatagtgataggagagattcccttcagcagaccaataccacccaccgtcccctg
catgtccaaaggccttcaattccacctgcaagtgatactgagaaaccgctgtttcctcca
gcaggaaattcggtgtgtcataaccatcataaccataattccataggaaagcaagctccc
agctcaacaaatgccaatctcaataatgccaatatgtccaaagctgcccctggaaagcgg
cccagcaatgggaaccttgagcatgtgtctgaaaatgggcatgattcctcccacaagcat
gaccatgagcctcaaagaaggtccagtattaaaagagcccgctattatgagacttacatt
aggtccgactcaggagatgagcagtttccaactatttgccgggaagacccggagatacag
ggttacttcagggacccctgctacttgggggagccggagtacttcagtggtgaggaggac
tacgaggacagctcgccgacctccagcaggcagaactacagctattacagccgacaccca
ggcagcagcgtggacttcgagcggccccgaggctaccatcacccccaagacttcttggag
gacagtgactcacccgtttgctatgattcccggagatctccaaggagacgcctactacct
cccactccaacatcccaccggagatcctccttcaactttgagtgcctgcgccggcagagc
agccaggaggagttcccaccgtcccctaccttcccccaccgcacagccctgcctctgcac
ctgatgcagcaacagatcatggcagtcgcaggcctagattcaagtaaagcccagaagtac
tcgccgagccactccacccggtcgtgggccacccctccagcgacccctccttaccaggac
tggacgccgtgctacacccccctgatccaggtggagcagacggaggccctggaccaggtc
aacggcagcctgccatccctgcaccgcagctcgtggtacacagacgagcctggcatctcc
tatcggaccttcacaccagccagtctgactgtccccagcagtttccacaacaaaaacagt
gacaagcagaggagcgcagacagcttggtggaggcagtcctgatatccgaaggcttagga
cggtatgcaagggacccaaaattcgtgtgtgcgacaaaacacgaaatcgctgatgcctgt
gacctaaccatcgacgagatggagagtgcagccagcaacctgcttaatgggacggtgcat
ccccgggcgaacggcgacgtgggccccatctcaggccagcaggactacgagctccaggac
ttcgggcccggctacagtgacgaagagccagaccccgggagggaggaggaggacctggca
gatgaaatgatctgcatcaccaccctgtag

KEGG   Miniopterus natalensis: 107536018
Entry
107536018         CDS       T05883                                 

Gene name
CACNA1S
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1S
  KO
K04857  voltage-dependent calcium channel L type alpha-1S
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04270  Vascular smooth muscle contraction
mna04723  Retrograde endocannabinoid signaling
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04911  Insulin secretion
mna04912  GnRH signaling pathway
mna04921  Oxytocin signaling pathway
mna04924  Renin secretion
mna04925  Aldosterone synthesis and secretion
mna04927  Cortisol synthesis and secretion
mna04929  GnRH secretion
mna04934  Cushing syndrome
mna04935  Growth hormone synthesis, secretion and action
mna05010  Alzheimer disease
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05410  Hypertrophic cardiomyopathy
mna05412  Arrhythmogenic right ventricular cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107536018 (CACNA1S)
   04020 Calcium signaling pathway
    107536018 (CACNA1S)
   04024 cAMP signaling pathway
    107536018 (CACNA1S)
   04022 cGMP-PKG signaling pathway
    107536018 (CACNA1S)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107536018 (CACNA1S)
   04929 GnRH secretion
    107536018 (CACNA1S)
   04912 GnRH signaling pathway
    107536018 (CACNA1S)
   04921 Oxytocin signaling pathway
    107536018 (CACNA1S)
   04935 Growth hormone synthesis, secretion and action
    107536018 (CACNA1S)
   04924 Renin secretion
    107536018 (CACNA1S)
   04925 Aldosterone synthesis and secretion
    107536018 (CACNA1S)
   04927 Cortisol synthesis and secretion
    107536018 (CACNA1S)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107536018 (CACNA1S)
   04261 Adrenergic signaling in cardiomyocytes
    107536018 (CACNA1S)
   04270 Vascular smooth muscle contraction
    107536018 (CACNA1S)
  09156 Nervous system
   04727 GABAergic synapse
    107536018 (CACNA1S)
   04725 Cholinergic synapse
    107536018 (CACNA1S)
   04726 Serotonergic synapse
    107536018 (CACNA1S)
   04723 Retrograde endocannabinoid signaling
    107536018 (CACNA1S)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107536018 (CACNA1S)
   05020 Prion disease
    107536018 (CACNA1S)
   05022 Pathways of neurodegeneration - multiple diseases
    107536018 (CACNA1S)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107536018 (CACNA1S)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107536018 (CACNA1S)
   05414 Dilated cardiomyopathy
    107536018 (CACNA1S)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107536018 (CACNA1S)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107536018 (CACNA1S)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107536018 (CACNA1S)
SSDB
Motif
Pfam: Ion_trans GPHH Ca_chan_IQ PKD_channel CAC1F_C
Other DBs
NCBI-GeneID: 107536018
NCBI-ProteinID: XP_016067108
LinkDB
Position
Unknown
AA seq 1881 aa
MEPSSPQDEGLRKKQPKKPVPEILPRPPRALLCLTLQNPLRKACISIVEWKPFETIILLT
IFANCVALAVYLPMPEDDNYSLNIGLEKLEYFFLIVFSIEAAMKIIAYGFLFHPDAYLRS
GWNVLDFIIVFLGVFTVILEQVNVIQSSTTPLGSKGAGLDVKALRAFRVLRPLRLVSGVP
SLQVVLNSIFKAMLPLFHIALLVLFMVTIYAIIGLELFKGKMHKTCYFIGTDIVATEENE
KPSPCARTGSGRPCTINGSECRGGWPGPNHGITHFDNFGFSMLTVYQCITMEGWTDVLYW
VNDAIGNEWPWIYFVTLILLGSFFILNLVLGVLSGXFTKEREKAKSRGTFQKLREKQQLD
EDLRGYMSWITQGEVMDVEDFREGKLSLDEGGSDTESLYEIEGLNKIIQFVRHWRQWNRI
FRWKCHDVVKSRVFYWLVILIVALNTLSIASEHHNQPLWLTHLQDVANRVLLSLFTIEML
MKMYGLGLRQYFMSIFNRFDCFVVCSGILEILLVESGAMSPLGISVLRCIRLLRLFKITK
YWTSLSNLVASLLNSIRSIASLLLLLFLFIVIFALLGMQLFGGRYDFEDTEVRRSNFDNF
PQALISVFQVLTGEDWNSVMYNGILAYGGPSYPGMLVCIYFIILFVCGNYILLNVFLAIA
VDNLAEAESLTSAQKAKAEERKRRKMSKGLPDRPEEEKAVVAKKLDQKPKGEGIPTTAKL
KIDEFESNVNEVKDPYPSADFPGDDEEDEPEIPASPRPRPLAELQLKEKAVPIPEASSFF
IFSPTNKIRVLCHRIVNATWFTNFILLFIMLSSAALAAEDPIRAESMRNQILGYFDIAFT
SVFTVEIVLKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLISMGLQSSSISVVKILRVLR
VLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVLVTTLLQFIFACVGVQLFKGKFFSCNDL
SKMTEKECRGYYYVYKDGDPTQIELHRREWTHNEFHFDNVLSAMMSLFTVSTFEGWPQLL
YKAIDAYEEDRGPVYNHRVEMAIFFIVYIILIAFFMMNIFVGFVIVTFQEQGETEYKNCE
LDKNQRQCVQYALKARPLKCYIPKNPYQYQVWYVVTSSYFEYLMFALIMLNTICLGMQHY
NQSEQMNQISDILNVAFTIIFTLEMILKLMAFKARGYFGDPWNVFDFLIVIGSIIDVILS
EIDTFLASSGGLYCLGGGCGTVDPDESARISSAFFRLFRVMRLIKLLSRAEGVRTLLWTF
IKSFQALPYVALLIVMLFFIYAVIGMQMFGKIALVDGTQINRNNNFQTFPQAVLLLFRCA
TGEAWQEVLLASSYGKLCDPESEYAPGEEYSCGTNFAYYYFISFYMLCAFLIINLFVAVI
MDNFDYLTRDWSILGPHHLDEFKAIWAEYDPEATGRIKHLDVVTLLRRIQPPLGFGKFCP
HRVACKRLVGMNMPLNSDGTVTFNATLFALVRTALKIKTEGNFEQANEELRAIIKKIWKR
TSMKLLDQVIPPIGDDEVTVGKFYATFLIQEHFRKFMKRQEEYYGYRPKKDAVQIQAGLR
TIEEEAAPEIRRTISGDLTAEEELERAMVEAAMEEGIFRRTGGLFGQMDNFLDRANSLAP
VMANQRPLQFSEIEMEELESPVFLEDFPQDPGTNPLARANTNNANANVAAGNSNHSNSQV
FPSARYEQESPGETEPPTARGGVLGQSLLSLLPSPYPPTGPRSQSCVEKQESQLTQRAVP
RAQASPAPCQYSRAESPMPEARRSPMPGPLPQEAPHSRRTPESPSRCLAPATALLIQEAL
LRGGLDTLAADAGFITATGQALAEACQMEPEDVEVAATELLRRRESPEGTAGALGPPSLR
SSLGSLDTCQGSQETLIPPRP
NT seq 5646 nt   +upstreamnt  +downstreamnt
atggagccgtcctccccccaggacgagggcctgaggaagaaacagcccaagaagccggtc
cccgagatcctgcccaggcccccccgggctttgctgtgcctgactctccagaacccgctg
aggaaggcctgcatcagcatcgtcgagtggaaacccttcgagaccatcatcttgctgacc
atctttgccaactgcgtggccctggccgtgtacctgcccatgcccgaggatgacaactac
tctctgaacattggcctggagaagctggagtatttcttcctgattgtcttctccatcgaa
gccgccatgaagatcatcgcctatgggttcctcttccaccccgacgcctacctgcgcagc
ggctggaatgtgctggatttcatcattgtcttcctgggggtcttcacagtgatcctggag
caggtgaatgtcatccagagcagcaccaccccgctgggcagcaaaggggccggcctggac
gtcaaggcgctgagggccttccgcgtgctcagacccctccggctggtgtcgggggtgccc
agcctgcaggtcgtcctcaactccatcttcaaggccatgctgccgctgttccacatcgcc
ctgctggtcctcttcatggtcaccatctacgccatcatcgggctggagctcttcaagggc
aagatgcacaagacgtgctacttcatcggcaccgacatcgtggccacggaagaaaacgag
aagccgtctccctgcgccaggacgggctcaggccgcccctgcaccatcaacggcagcgag
tgccggggtggctggccggggcccaaccacggcatcacgcactttgacaacttcggcttc
tccatgctcaccgtgtaccaatgcatcaccatggagggctggaccgacgtcctgtactgg
gtcaacgatgccatcgggaacgagtggccctggatctactttgtcactctcattctgctg
gggtccttcttcattctcaacctggtgctgggagtcctgagcggnnnnttcaccaaggag
cgggagaaggccaagtcccggggcaccttccagaagctccgggagaagcagcagctcgac
gaggacctgcgcggctacatgagctggatcacgcagggcgaggtcatggacgtggaggac
tttcgagaaggaaagctgtctttggacgaaggaggctccgacactgagagcctgtatgag
atcgagggtttgaacaaaattatccagtttgtccgacactggaggcagtggaaccgcatc
ttccgctggaagtgccatgacgtggtcaagtccagagtcttctactggctggtgatcctg
atcgtggccctcaacaccttgtccattgcctctgagcaccacaaccagccgctgtggttg
actcacctgcaagacgttgccaaccgggtgctgctgtccctcttcaccatcgagatgctg
atgaagatgtacgggctgggcctgcgccagtacttcatgtccatcttcaaccgcttcgac
tgcttcgtggtgtgcagcggcatcctggagatcctgctggtggagtcgggcgccatgagc
cccctgggcatctcagtgctgcgctgcatccgcctcctgaggctcttcaagatcaccaag
tactggacgtcgctgagcaacctggtggcgtccctgctcaactccatccgctccatcgcc
tcgctgctgctgctgctgttcctcttcattgtcatctttgccctgctgggcatgcagctc
ttcgggggccggtacgacttcgaggacaccgaggtgcggcgcagcaacttcgacaacttc
ccgcaggccctcatcagtgtcttccaggtcctgacgggcgaggactggaactcggtgatg
tacaacggcatcctggcctacggcgggccctcctaccccggcatgctcgtgtgcatatac
ttcatcattctcttcgtctgcggcaactatattctgctcaatgtcttcctggccatcgcc
gtggacaacctggctgaggcggagagcctgacttccgcccagaaggccaaggccgaggag
agaaagcgcaggaagatgtctaaggggctcccagacaggcccgaggaggagaaggcagtg
gtggccaagaagctggaccagaagcccaaaggcgaggggattcccaccaccgccaagcta
aaaatcgacgaattcgagtccaacgtcaatgaggtgaaggacccctacccctccgctgac
ttcccaggcgacgatgaagaagatgagcccgagatccccgcgagcccccgcccgcggccg
ctggccgagctgcagctgaaggagaaggcggtgcccatccccgaagccagctctttcttc
atcttcagccccaccaataagattcgcgtcctatgtcatcgcatcgtcaacgccacctgg
ttcaccaacttcatcctgctgttcatcatgctcagcagcgccgcgctggccgccgaggac
cccatccgggccgagtccatgaggaatcagatcctcgggtattttgacattgcattcacc
tctgtcttcactgtggagattgtcctcaagatgaccacttacggcgctttcctgcacaag
ggctccttctgccgcaactacttcaacatcctggacctgctggtggtggccgtgtccctc
atctccatgggactccagtccagctccatctctgtggtgaagatcctcagggtgctgagg
gtgctccgacccctgcgagccatcaacagagccaaggggctgaagcacgtggtacagtgc
gtgttcgtggccatccgcaccatcggcaacatcgtcctggtcaccaccctcctgcagttc
atttttgcctgcgtcggggtccagctcttcaagggcaagttcttcagctgcaacgacttg
tccaagatgaccgagaaggagtgcaggggctattactacgtgtataaggacggggacccc
acacagatagagctgcatcgccgcgagtggacacacaacgaattccactttgacaacgtg
ctgtcagccatgatgtccctcttcacagtctccaccttcgaggggtggccacagctcctg
tacaaggccatcgacgcttacgaggaggacaggggccccgtgtacaaccaccgggtggag
atggccatcttcttcatcgtctacatcattctcattgccttctttatgatgaacatcttc
gtgggctttgtcattgtcaccttccaggagcagggcgagaccgagtacaagaactgcgag
ctggacaagaaccagcgccagtgtgtgcagtacgccctgaaggcccgcccactgaagtgc
tacatccccaagaacccctaccagtaccaggtgtggtacgtggtcacctcctcctacttt
gagtatctgatgtttgccctcatcatgctcaacaccatctgcctgggcatgcagcactac
aaccagtcagagcagatgaaccaaatctccgacatcctcaacgtggccttcaccatcatt
ttcaccctggagatgatcctcaagctcatggcattcaaggccaggggctattttggagac
ccctggaatgtgtttgacttcctgatcgtcattggcagcatcatcgatgtcatcctcagc
gagattgatactttcctggcctccagcgggggactgtattgcctgggtggaggctgcggg
accgtagacccagacgagagcgcgcgcatttccagcgccttcttccgcctgttccgggtc
atgaggctgatcaagctgctgagccgggcggagggagtgcggaccctgctgtggacgttc
atcaagtccttccaggccctcccctacgtggccctgctcatcgtgatgctgttcttcatc
tacgcggtcatcggcatgcagatgttcgggaaaatcgccctggtggacggaacccaaata
aaccggaacaacaacttccagaccttcccgcaggccgtgctgctgctcttcaggtgtgcg
acgggtgaggcgtggcaggaggtgctgctggccagcagctacggcaagctgtgcgaccca
gagtccgagtacgcgccaggcgaggagtactcgtgcggcaccaacttcgcgtattactac
ttcatcagcttctacatgctctgcgccttcctgatcatcaacctcttcgtggctgtcatc
atggacaatttcgactacctcacacgagactggtccatcctgggccctcaccacctggac
gagttcaaggccatctgggcggagtatgacccggaggctacgggccgaatcaaacacctg
gacgtggtgaccctgctgaggaggatccagcccccactgggtttcgggaagttctgcccc
caccgggtggcatgcaagcggctcgtgggcatgaacatgcccctgaacagcgacggcacc
gtcaccttcaacgccaccctcttcgccctggtccgcacggccctcaagatcaagacagaa
ggtaactttgagcaggccaatgaggaactgagggccatcatcaagaagatctggaagaga
accagcatgaagctcctggaccaggtcatccctccgatcggagatgacgaggtgaccgtg
ggcaagttctacgccacgttcctcatccaggagcatttccgcaagttcatgaagcgccag
gaggagtattacgggtatcggcctaagaaggacgccgtgcagatccaggccggactgcgg
accattgaggaggaggcggcgcctgagatccgccggaccatctcgggagacctgacagcc
gaggaggagctggagagggccatggtggaggcagcgatggaggaagggatattccggaga
actggaggcctgtttggccaaatggacaacttcctggatagggccaactccctggccccc
gtcatggccaaccagaggcccctccagttttccgagatagagatggaagagctggagtcg
cccgtcttcttggaggacttccctcaagatccgggcaccaatccccttgctcgtgccaat
accaacaatgccaatgccaatgttgccgccggcaacagcaaccatagcaacagccaggtg
tttcccagtgcccgctatgaacaggagtcccctggagagacagagccgcctacagccaga
ggaggagtcctgggtcagtctcttctgtccctcctgccctcgccctatccacccacagga
ccccgcagccaatcctgtgtggaaaagcaggaaagccagctgactcagagagcggtgccc
agagcccaggcctctcctgccccctgccagtactccagggcggagagccccatgcctgaa
gcgagaagaagccccatgccagggcctctgccccaggaagccccccacagccgcaggacc
cccgagagcccttccagatgcctggctccagccactgccctgttgatacaggaggctcta
cttcgagggggcttggacaccttggcagccgatgctggcttcatcacagcgacaggccag
gccctggcagaggcctgccagatggaaccagaggacgtggaggtggcagccacagagcta
ctgagaagacgagagtcccccgagggcacagccggtgccctggggcccccgagcctcagg
tcctccctgggcagccttgacacgtgtcaaggctctcaggagaccctcattccccccagg
ccatga

KEGG   Miniopterus natalensis: 107536136
Entry
107536136         CDS       T05883                                 

Gene name
CACNA1B
Definition
(RefSeq) voltage-dependent N-type calcium channel subunit alpha-1B
  KO
K04849  voltage-dependent calcium channel N type alpha-1B
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04020  Calcium signaling pathway
mna04721  Synaptic vesicle cycle
mna04723  Retrograde endocannabinoid signaling
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04930  Type II diabetes mellitus
mna05016  Huntington disease
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05032  Morphine addiction
mna05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107536136 (CACNA1B)
   04020 Calcium signaling pathway
    107536136 (CACNA1B)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107536136 (CACNA1B)
   04725 Cholinergic synapse
    107536136 (CACNA1B)
   04728 Dopaminergic synapse
    107536136 (CACNA1B)
   04726 Serotonergic synapse
    107536136 (CACNA1B)
   04723 Retrograde endocannabinoid signaling
    107536136 (CACNA1B)
   04721 Synaptic vesicle cycle
    107536136 (CACNA1B)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    107536136 (CACNA1B)
   05020 Prion disease
    107536136 (CACNA1B)
   05022 Pathways of neurodegeneration - multiple diseases
    107536136 (CACNA1B)
  09165 Substance dependence
   05032 Morphine addiction
    107536136 (CACNA1B)
   05033 Nicotine addiction
    107536136 (CACNA1B)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107536136 (CACNA1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107536136 (CACNA1B)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107536136 (CACNA1B)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 107536136
NCBI-ProteinID: XP_016067249
LinkDB
Position
Unknown
AA seq 2102 aa
LNPRTPFEYMILATIIANCIVLALEQHLPEGDKTPMSERLDDTEPYFIGIFCFEAGIKII
ALGFVLHKGSYLRNGWNVMDFVVVLTGDPPPPAGLQVVLKSIMKAMVPLLQIGLLLFFAI
LMFAIIGLEFYMGKFHKACFPNGTEGDPVGDFPCGKEAPARLCEGDTECREYWPGPNFGI
TNFDNILFAILTVFQCITMEGWTDILYSTNDAAGNTWNWLYFIPLIIIGSFFMLNLVLGV
LSGEFAKERERVENRRAFLKLRRQQQIERELNGYLEWIFKAEEVMLAEEDKNAEEKSPLD
VLKRAATKKSRNDLIHAEEGEDRFADLCAVGSPFARASLKSGKTEGSSYFRRKEKMFRFF
VRRMVKAQSFYWVVLCVVALNTLCVAMVHYNQPQRLTTALYFAEFVFLGLFLTEMSLKMY
GLGPRSYFRSSFNCFDFGVIVGSIFEVVWAAIKPGTSFGISVLRALRLLRIFKVTKYWNS
LRNLVVSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFKDETPTTNFDTFPAAIL
TVFQILTGEDWNAVMYHGIESQGGVSKGMLSSFYFIVLTLFGNYTLLNVFLAIAVDNLAN
AQELTKDEEEMEEAANQKLALQKAKEVAEVSPMSAANVSITAFVKQTRGTVSRSSSVSSV
NSPRQQNSAKARSVWEQRASQLRLQNLRASCEALYSELDPEERLRYATTRHLRPDMKTHL
DRPLVVEPGRDGARGPSAEEPVRRHRARHRAPPAHEDAEKEAKEAAAKEGEGEDRDKEKE
PRNPQPQEPHCDLEASGIMGVGPVHALPSTCVQKVEEQPEDADNQRNVTRMGSQPSDPSA
TAHIPVTQTGPPGETTVVPSGSVDLDGQAEGKKEVEANDEMRSGPRPIVPYSSMFCLSPT
NLLRRFCHYIVTMRYFEMVILIVIALSSIALAAEDPVHTDSPRNNVLKYMDYIFTGVFTF
EMVIKMIDLGLLLHPGAYFRDLWNILDFIVVSGALVAFAFSGSKGKDINTIKSLRVLRVL
RPLKTIKRLPKLKAVFDCVVNSLKNVLNILIVYMLFMFIFAVIAVQLFKGKFFYCTDESK
ELERDCRGQYLDYEREEVEAQPRQWKKYDFHYDNVLWALLTLFTVSTGEGWPMVLKHSVD
ATYEEQGPSPGFRMELSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKVMSECSLEKNE
RACIDFAISAKPLTRYMPQNKQSFQYRTWTFVVSPPFEYFIMAMIALNTVVLMMKFYDAP
YEYELMLKCLNIVFTSMFSMECVLKIIAFGVLNYFRDAWNIFDFVTVLGSITDILVTEIA
NNFINLSFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGM
QVFGNIALDDDSSINRHNNFRTFLQALMLLFRSATGEAWHEIMLSCLSNQACDEQANASE
CGSDFAYFYFVSFIFLCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFIRVWAEYDP
AACGRITYSDMFEMLKHMSPPLGLGKKCPARVAYKRLVRMNMPISNEDMTVHFTSTLMAL
IRTALEIKLAPAGTKQHQCDAELRKEISCVWANLPQKTLDLLVPPHKPDEMTVGKVYAAL
MIFDFYKQSKTSRDQTHQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLQQKSSA
SLSNGGAVQTQESGIKESVSWGTQRTQEVPYEARAPLERGHSTEIPVVQPGKPAVDVQMQ
SMALRGPDGEPQSGLESQGRAASMPRLAAETQAASEASPMKRSVSTLAPQRPHVAHLCNA
ALDRAPASQAAPHHHHRCHRRRDRKQKSLEKGPSLSADADGAPSSTAGPGPPPGEGPTGG
RRERRQERQERGRSQERRQPSSSSSEKQRFYSCDRFGGREPLQPRPSLCSHPTSPTAGQE
PGPPRQGSGSVNGSPLLSTSGASTPGRGGRRQLPQTPLTPRPSVTYKTANSSPVHFAGAQ
SSLPTFSPGRLSRGLSEHNALLQRDPLSQPLAPSSRIGSDPYLGQRLDSDAAVRTQPEDM
LTFEEAVATNSGRSSRTSYVSSLTSQSHPLRRVPNGYHCTLGLGSGGRARHSYHHPDQDH
WC
NT seq 6309 nt   +upstreamnt  +downstreamnt
cttaacccgcgcactccgttcgagtacatgatcctggccaccatcatcgccaactgcatc
gtgctggccctggagcagcacctccctgagggcgacaagacgcccatgtccgagcgcctg
gacgacaccgagccctatttcatcggcatcttctgcttcgaggcggggatcaagatcatt
gcgctgggcttcgtgctgcacaaggggtcctacctgcgcaacggctggaacgtcatggac
ttcgtggtggtcctcaccggtgacccgcccccgcccgcaggcctgcaggtggtgctcaag
tccatcatgaaggccatggtgccgctgctgcagatcgggctgctgctcttcttcgccatc
ctcatgttcgccatcattggcctcgagttctacatgggcaagttccataaggcctgtttc
cccaatggcacagaaggagacccagtgggcgacttcccctgtggcaaagaggcgcctgcc
cggctgtgtgagggagacaccgagtgccgggagtactggccaggacccaactttggcatc
accaacttcgacaacatcctgttcgccatcctgacagtattccagtgcatcaccatggag
ggctggacagacatcctctacagcacaaatgatgctgctggcaacacctggaactggctg
tatttcatccctctcatcatcatcggctccttcttcatgctcaacctggtactgggcgtg
ctctcgggagagttcgccaaggagcgtgagcgggtggagaaccgccgggccttcctgaag
ctgcggcggcagcagcagatcgaaagggagctcaacgggtacctggagtggatcttcaag
gccgaggaagtcatgctggctgaggaggacaagaatgccgaggagaagtcccccctggat
gtgttgaagagggcagccaccaagaagagccgaaatgacctgatccatgctgaggaggga
gaggaccggtttgcagacctctgtgccgtggggtcccccttcgcccgtgccagcctcaag
agtgggaagacggagggctcgtcctacttccgcaggaaggagaagatgttccggttcttt
gtgcggcgcatggtgaaggcacagagcttctactgggtggtgctgtgcgtggtggccctg
aacacgctgtgtgtggccatggtgcactacaaccagccccagcggctcaccacagcgctg
tactttgcagagtttgttttcctgggtctcttcctcacagagatgtccctgaagatgtat
ggcttggggcccaggagttacttccggtcctccttcaactgctttgactttggggtcatt
gtggggagcatcttcgaagtggtctgggctgccatcaagccaggaacctcctttgggatc
agcgtgctgcgggcactccggctgctgaggatcttcaaagtcacgaagtactggaactct
ttgcggaacctggtggtgtcactgctcaactccatgaagtcgatcatcagcctcctgttc
ctgctcttcctgttcattgtggtcttcgccctgctgggcatgcagctgtttgggggacag
ttcaactttaaagatgagactccaacaaccaactttgacaccttccctgccgccatcctc
actgtcttccagatcctgaccggagaggactggaacgcagtgatgtaccacgggatcgag
tcgcagggtggcgtcagcaagggcatgctgtcgtccttctacttcatcgtcctgacgctg
tttggaaactacaccttactgaacgtattcctggccattgctgtggacaatcttgccaat
gcccaggagctgaccaaggatgaagaggagatggaagaagcagccaatcagaagcttgct
ctgcagaaggccaaggaagtggctgaagtcagccccatgtcagccgcgaacgtctccatc
actgcttttgtaaagcaaactcgaggtactgtatctcgcagctcgtctgtctccagcgta
aactcacccaggcagcagaactcagccaaggcgcgctccgtgtgggagcagcgggcgagc
cagctgcggctgcagaacctgcgggccagctgcgaggcgctgtacagcgagctggacccc
gaggagcggctgcgctacgccaccacgcgccacctgcggcccgacatgaagacgcacctg
gaccggccgctggtggtggagcccggccgcgatggcgcgcggggcccgagcgcggaggag
ccagtgcggaggcaccgggcccggcacagggcgccgcccgcgcacgaggatgccgagaag
gaggccaaggaggcggcagcgaaggagggcgagggcgaggaccgggacaaggagaaggag
ccgcggaacccccagccccaggagccacactgtgacctggaggccagtgggataatgggc
gtgggtccagtgcatgcactgcccagcacctgtgtacagaaggtggaagaacagccagag
gatgcagataatcagcggaacgtcactcgaatgggcagtcaaccctcagacccaagtgcc
actgctcatatcccagtgacacagactggccctcctggggagaccacagttgttcccagc
ggcagcgtggacctggacggccaggcggaggggaagaaggaggtggaagccaatgacgag
atgaggagtggcccccgccccatcgtcccatacagctccatgttctgtctgagccccacc
aacctgctccgccgcttctgccattacatagtgaccatgcggtacttcgagatggtcatc
ctcatagtcattgccctgagcagcatcgccctggccgcagaggaccctgtgcacacagac
tcccccaggaacaatgttctgaagtacatggactacatcttcacaggtgtcttcaccttt
gagatggtgataaagatgattgatttgggactgctgctgcacccaggggcctacttccga
gacctgtggaacattctggacttcattgtggtcagtggggccctggtggcgtttgccttc
tcaggatccaaagggaaggacatcaataccatcaagtccctgagagtcctgcgcgtcctg
cgacccctgaagaccatcaagcggctgccgaagctcaaggccgtgttcgactgtgtggtg
aactcactgaagaacgttctcaacatcctcatcgtctacatgcttttcatgttcatcttc
gccgtcatcgccgtgcagctgttcaaggggaagttcttctactgcaccgacgagtccaag
gagctggagcgggactgcaggggccagtacttggattacgagcgggaggaggtggaagct
caaccacggcagtggaagaagtacgacttccactatgacaacgtgctctgggcactgctc
acgctgttcacggtgtccacgggagaagggtggcccatggtgctgaagcactccgtggac
gccacctacgaggagcagggcccgagccctgggttccgcatggagctgtccatcttctac
gtggtctacttcgtggtcttccccttcttcttcgtcaacatcttcgtggccttaatcatc
atcacgttccaggagcagggcgacaaagtgatgtctgagtgcagcctggagaagaatgag
agagcctgcattgacttcgccatcagcgccaagcccctgacgcggtacatgccacagaac
aagcagtccttccagtacaggacgtggaccttcgtggtctcgccacccttcgagtacttc
atcatggccatgatcgctctcaacaccgtggtgctgatgatgaagttctatgatgcgccc
tacgagtacgagctgatgctgaagtgcctgaacatcgtgttcacgtccatgttctccatg
gagtgcgtgctcaagatcatcgcctttggggtgctgaactacttcagagatgcctggaac
atcttcgactttgtcactgtgttgggaagtattactgatattttagtaacagagattgcg
aacaacttcatcaacctcagcttcctgcgccttttccgcgccgcccggctcatcaagctg
ctgcgccagggctacaccatccgcatcctgctctggacgttcgtgcagtccttcaaggcc
ctgccctacgtgtgcctgctgatcgccatgctgttcttcatctatgccatcatcggcatg
caggtgtttggaaacattgccctggatgatgactccagcatcaacaggcacaacaacttc
cggacgtttctacaagccctgatgctgctgttcaggagtgccaccggggaggcctggcat
gagatcatgctgtcctgtctcagcaaccaggcctgtgatgagcaagccaatgccagtgag
tgcggcagcgactttgcctacttctacttcgtctccttcatcttcctgtgctcctttctg
atgttgaacctgtttgtggctgtgatcatggacaattttgagtacctcacgcgggactct
tccatcctagggcctcaccacctggacgagttcatcagggtctgggctgagtacgacccc
gctgcgtgtgggcgcatcacttacagtgacatgtttgagatgctgaaacacatgtccccg
cccctggggctggggaagaaatgccctgctcgagtggcgtacaagcgcctggttcgcatg
aacatgcccatctccaatgaggatatgaccgtccatttcacgtccacactgatggccctc
atccggactgcactggagatcaagctggctccagccggcacgaagcagcaccagtgtgat
gcagaactgaggaaggagatttcctgtgtgtgggccaatcttccccagaagactctggac
ttgttggtgccgccccacaaacctgacgagatgacggtggggaaggtctacgcagctctg
atgatcttcgacttctacaaacagagcaagaccagcagagaccagacccaccaagctcct
ggaggcctgtcccagatgggcccggtgtccctgtttcaccctctgaaggctacactggag
cagacgcagccggctgtgctccgaggagcccgggtttttcttcagcagaagagctcagcc
tccctgagcaatggcggggccgtgcaaacccaagagagtggcatcaaggagtctgtttcc
tggggcactcagaggacgcaagaagtgccctatgaggcaagggcccccttggagcgaggc
cactcgacagaaatcccagtggtgcagccaggaaaaccagctgtggatgtccagatgcag
agcatggccctgaggggccctgacggggagccccagtccgggctggagagccagggccga
gcggcctccatgccccgcctggcagcagagacccaggcggcctcagaggccagccccatg
aagcgctcagtctccacgctggcgccccagcgcccccatgtggctcatctctgcaatgcc
gccctggaccgggctccagccagccaggccgccccccaccaccaccaccgctgccaccgc
cgccgggacaggaaacagaagtccctggagaaggggcccagcctatccgcagatgcagat
ggtgcccccagcagcactgcagggccagggccgcccccaggagaggggcccacaggcggc
cggcgggagcgcaggcaggagaggcaggagcggggtcggtcccaggagcgcaggcagccc
tcctcctcctcctctgagaagcagcgcttctactcgtgtgaccgctttgggggccgggag
cccctgcagcccaggccctccctctgcagccatcccacatcgccaaccgctgggcaggag
ccaggacccccgagacagggcagcggttccgtaaacgggagccccctactgtccacatct
ggtgctagcacccctggccgcggtgggcggaggcagcttccccagactccactgacgccc
cggcccagtgtcacctacaagacagccaactcctcgcccgtgcacttcgccggggcccag
agcagtctccccaccttctccccgggccggctgagccgaggcctttcagaacacaatgcc
ctgctccagagggaccccctcagtcagccgctcgcccccagctctcggattggctctgac
ccttacctggggcagcgtctggacagtgacgccgcagtgcgcacccaaccagaggacatg
ctcacctttgaggaggccgtggccaccaactcgggccgctcctcccggacttcctacgtg
tcctccctgacctcccagtcccacccactgcgccgggtgcccaatggctaccactgcact
ctggggctcggctcaggcggccgcgctcggcacagctaccaccacccggaccaagaccac
tggtgctag

KEGG   Miniopterus natalensis: 107541038
Entry
107541038         CDS       T05883                                 

Gene name
CACNA1A
Definition
(RefSeq) voltage-dependent P/Q-type calcium channel subunit alpha-1A
  KO
K04344  voltage-dependent calcium channel P/Q type alpha-1A
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04020  Calcium signaling pathway
mna04721  Synaptic vesicle cycle
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04730  Long-term depression
mna04742  Taste transduction
mna04930  Type II diabetes mellitus
mna05017  Spinocerebellar ataxia
mna05032  Morphine addiction
mna05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107541038 (CACNA1A)
   04020 Calcium signaling pathway
    107541038 (CACNA1A)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    107541038 (CACNA1A)
   04727 GABAergic synapse
    107541038 (CACNA1A)
   04725 Cholinergic synapse
    107541038 (CACNA1A)
   04728 Dopaminergic synapse
    107541038 (CACNA1A)
   04726 Serotonergic synapse
    107541038 (CACNA1A)
   04730 Long-term depression
    107541038 (CACNA1A)
   04723 Retrograde endocannabinoid signaling
    107541038 (CACNA1A)
   04721 Synaptic vesicle cycle
    107541038 (CACNA1A)
  09157 Sensory system
   04742 Taste transduction
    107541038 (CACNA1A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    107541038 (CACNA1A)
  09165 Substance dependence
   05032 Morphine addiction
    107541038 (CACNA1A)
   05033 Nicotine addiction
    107541038 (CACNA1A)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107541038 (CACNA1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107541038 (CACNA1A)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107541038 (CACNA1A)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel DUF2207
Other DBs
NCBI-GeneID: 107541038
NCBI-ProteinID: XP_016073449
LinkDB
Position
Unknown
AA seq 2199 aa
MYKQSMAQRARTMALYNPIPVRQNCLTVNRSLFLFSEDNVVRKYAKKITEWPPFEYMILA
TIIANCIVLALEQHLPDDDKTPMSERLDDTEPYFIGIFCFEAGIKIIALGFAFHKGSYLR
NGWNVMDFVVVLTGILATVGTEFDLRTLRAVRVLRPLKLVSGIPSLQVVLKSIMKAMIPL
LQIGLLLFFAILIFAIIGLEFYMGKFHTTCFEEGTDDIQGESPAPCGTEEPARTCPNGTK
CQPYWEGPNNGITQFDNILFAVLTVFQCITMEGWTDLLYNSNDASGNTWNWLYFIPLIII
GSFFMLNLVLGVLSGEFAKERERVENRRAFLKLRRQQQIERELNGYMEWISKAEEVILAE
DETDGEQRHPFDALRRATIKKSKTDLLNPEEAEDQLADIASVGSPFARASIKSAKLENST
FFHKKERRVRFYIRRMVKTQAFYWTVLSLVALNTLCVAIVHYNQPEWLSDFLYYAEFIFL
GLFMSEMFIKMYGLGTRPYFHSSFNCFDCGVIIGSIFEVIWAVIKPGTSFGISVLRALRL
LRIFKVTKYWASLRNLVVSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFDEGTP
PTNFDTFPAAIMTVFQILTGEDWNEVMYDGIKSQGGVQGGMVFSIYFIVLTLFGNYTLLN
VFLAIAVDNLANAQELTKDEQEEEEAANQKLALQKAKEVAEVSPLSAANLSIAVKEQQKN
QKPTKSVWEQRTSEMRKQNLLASREALYNEMDPDERWKATYARHLRPDMKTHLDRPLVVD
PQENRNNNTNKSRAAEPTVDQRLGQQRAEDFLRKQARFHDRGGERRRRHRHGAAATYDPD
ARREDKERRHRRRKKQPSWQEKQQLKSGEVGSDITWGSRTSVPGTLAGFGTRLSMSEVDT
QGSGVPVSGPNLSTTRPIQQDLGRQDPPLAEDIDNMKNNKLATAESASPHDSLGHPGLSQ
SPAKMGNSTNPGPTTAPSATATNPQNTTSRRMPNNPGNPSNPGPPKTPENSLIVTNPSTT
QTNSAKTARKPDHTAVDIPPACPPPLNHTVVQVNKNANPDPLPKKEEEKKEEEEDDPGED
GPKPMPPYSSMFILSTTNPLRRLCHYILNLRYFEMCILMVIAMSSIALAAEDPVQPNAPR
NNVLRYFDYVFTGVFTFEMVIKMIDLGLVLHQGAYFRDLWNILDFIVVSGALVAFAFTGN
SKGKDINTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVNSLKNVFNILIVYMLFMFIFAV
VAVQLFKGKFFHCTDESKEFEKDCRGKYLLYEKNEVKARDREWKKYEFHYDNVLWALLTL
FTVSTGEGWPQVLKHSVDATFENQGPSPGYRMEMSIFYVVYFVVFPFFFVNIFVALIIIT
FQEQGDKMMEEYSLEKNERACIDFAISAKPLTRHMPQNKQSFQYRMWQFVVSPPFEYTIM
AMIALNTIVLMMKFYGASLAYENALRVFNIVFTSLFSLECLLKVMAFGILNYFRDAWNIF
DFVTVLGSITDILVTEFGNNFINLSFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALP
YVCLLIAMLFFIYAIIGMQVFGNIGIDVEDEDSEEDDFQITEHNNFRTFFQALMLLFRSA
TGEAWHNIMLSCLSGKPCDKNSGILTPECGNEFAYFYFVSFIFLCSFLMLNLFVAVIMDN
FEYLTRDSSILGPHHLDEYVRVWAEYDPAAWGRMPYPDMYQMLRHMSPPLGLGKKCPARV
AYKRLLRMDLPVADDNTVHFNSTLMALIRTALDIKIAKGGADKQQMDAELRKEMMAIWPN
LSQKTLDLLVTPHKSTDLTVGKIYAAMMIMEYYRQSKAKKLQAMREEQNRTPLMFQRMEP
PSPTQEGGPGQNALPSTQLDPGGSLMAHESGIKESPSWVTQRAQEMFQKTGTWSPERGPP
TDMPNSQPNSQSVEMREMGRDGYSDSERYLPTEGQARAASMPRLPAENQRRRGRPRGNNL
STISDTSPMKRSASVLGPKARRLDDYSLERVPPEENQRHHQRRRDRGHRASERSLGRYTD
VDTGLGTDLSMTTQSGDLPSKERDQERGRPKDRKHRQHHHHHHHHHPQPPDKERYTQERP
DHRARARDQRWSRSPSEGPEHMTHRQVGVAGVAPRPSHGGPGKEGGPYTPQLLWAGSSLP
TVTSDPAYHWASSQAKGGLDTGVLAGYTKPYYYCLQKPI
NT seq 6600 nt   +upstreamnt  +downstreamnt
atgtacaagcagtcaatggcgcagagagcgcggaccatggccctctacaaccccatcccc
gtccgacagaactgcctcacggtcaaccggtctctgttcctcttcagcgaggacaacgtg
gtgagaaaatacgccaaaaagatcaccgaatggcctccctttgaatatatgattttagcc
accatcatagcaaactgcatcgtccttgccctggagcaacacctacctgacgatgacaag
acccccatgtctgaacgactggatgacacagaaccgtacttcattggaattttttgtttc
gaggctggcattaaaatcattgcccttgggtttgccttccacaaaggctcttacctgagg
aatggttggaacgtgatggacttcgtggtggtgctaacaggcatcttggcgacagttggg
acagagtttgacctacggacgctgagggcagttcgagtgctgcgaccgctcaagctggtg
tctggaatcccaagtttacaagtcgtcctgaagtcgatcatgaaggcgatgatccccttg
ctgcagattggccttctcctattttttgcaatccttatttttgcaatcatagggttagaa
ttttatatgggaaaatttcataccacctgctttgaagaggggacagatgacattcagggt
gaatctccggctccatgtgggacagaggaacccgcccgcacctgccccaatgggaccaaa
tgccagccctactgggaagggcccaacaatgggatcactcagttcgacaacatcctgttt
gcagtgctgactgttttccagtgcatcaccatggaagggtggactgacctcctctacaac
agcaacgatgcctcagggaacacttggaactggttgtacttcatccccctcatcatcatc
ggctccttttttatgctgaacctcgtgctgggtgtgctgtcaggggagtttgccaaagag
agggagcgggtggagaaccggcgggcttttctgaagctgaggaggcagcaacagattgaa
cgagagctcaatgggtacatggagtggatctcgaaagcagaagaggtgatcctcgccgag
gatgaaactgacggggagcagaggcatccctttgatgctctgcggagagccaccataaag
aagagcaagacagacctgctcaaccccgaggaggctgaggatcagctagccgacattgcc
tctgtggggtctccctttgcccgagccagcattaaaagtgccaagttggagaactcgact
ttttttcacaaaaaggagaggagggtgcgtttctacatccgccgcatggtcaaaactcag
gccttctactggactgtgctcagtctggtagccctcaacacgctgtgtgttgctatcgtt
cactacaaccagcccgagtggctctccgacttcctctactatgcagaattcattttctta
ggactctttatgtccgaaatgtttataaaaatgtacgggcttgggacacggccttatttc
cactcttccttcaactgctttgactgtggggttatcatcgggagcatctttgaggtcatc
tgggccgtcataaaacccggcacatcctttggaatcagtgtgttacgagccctcaggtta
ttgcgtattttcaaagtcacaaagtactgggcgtctctcaggaatctggtcgtctctctt
ctcaactccatgaaatccatcatcagcctgttgttcctccttttcctgttcatcgtcgtc
tttgcacttttaggaatgcagctctttggcggccagtttaatttcgatgaagggactcct
cctaccaactttgacacttttccagcagcaataatgacagtgtttcagatcctgacgggc
gaggactggaacgaggtcatgtacgacggcatcaaatctcagggcggcgtgcagggcggc
atggtgttctccatctacttcatcgtgttgacactcttcgggaactacaccctcctgaac
gtgttcttggccatcgcggtggataatttggccaacgcccaggagcttaccaaggatgaa
caagaagaagaagaggcagccaaccagaaactcgccctccagaaagccaaggaggtggca
gaagtgagtcctctgtccgcggccaacttgtccatagctgtgaaggagcaacagaagaac
cagaagccaaccaagtccgtgtgggagcagcggaccagcgagatgcgcaaacagaacctg
ctggccagccgggaggccctgtacaacgagatggaccccgacgagcgctggaaagccacc
tatgcgcggcacctgcggcccgacatgaagacccacctggaccggccgctggtggtggat
ccccaggagaaccgcaacaataacaccaacaagagccgcgcggccgagcccacggtagac
cagcgcctgggccagcagcgggccgaggacttcctccgcaagcaggcgcgcttccacgac
cggggcggcgagcggaggcggcggcaccggcacggcgccgcggccacctacgacccggac
gcgcggagggaggacaaggagcgcaggcaccggcggaggaagaaacagccatcctggcag
gagaagcagcagctgaaatctggggaggtgggcagtgacattacatggggatcaagaacc
tcagtgcccggcacactggccggcttcgggacacgcctctcaatgtccgaggtagacacc
cagggctccggggtacccgtgtcgggccccaacctgtcgaccacccggccgatccagcaa
gacctaggtcgccaagacccgccgctggccgaggacatcgacaacatgaagaacaacaag
ctggccactgcagaatcggccagtccccacgacagcctcggccaccccggcctgtcccag
agcccagccaagatggggaacagcaccaaccccggccccacaacggccccatctgccacg
gccaccaatccccagaataccaccagtcgccggatgcccaacaacccggggaacccctcc
aaccccggcccccccaagactcccgagaacagccttatcgtcaccaaccccagcaccacc
cagaccaactcagctaagactgccaggaaacccgaccacaccgcggtggacatcccccca
gcctgcccgccacccctcaaccacaccgttgtccaagtgaacaaaaacgccaacccagac
ccactgccaaaaaaagaggaagagaagaaggaggaggaggaagacgaccccggggaagac
ggccccaagcccatgcccccctacagttccatgtttatcctttccacgaccaaccccctt
cgccgcctgtgccattacattctgaacctgcgctactttgagatgtgcatcctaatggtc
atcgccatgagcagtattgccctggcggctgaggaccccgtgcagcccaacgcaccacgg
aacaatgtgctacgatattttgactacgttttcacaggcgtctttacctttgagatggtg
atcaagatgattgacctggggctcgtcctgcaccagggtgcctacttccgtgacctctgg
aacattcttgacttcatagtggtcagtggggccctggtggcctttgccttcactggcaat
agcaaaggaaaggacattaacacaatcaaatctctccgagtcctccgggtgctacgacct
cttaaaaccatcaagcggttgccaaagctcaaggccgtgtttgactgtgtggtgaattcc
ctcaagaatgtcttcaacatcctcattgtctacatgctgttcatgttcatctttgccgtg
gtggccgtgcagctcttcaaggggaagttcttccactgcaccgatgagtccaaggagttt
gagaaagactgtcgcggcaagtacctcctgtacgagaagaacgaggtgaaggcgcgggac
cgcgagtggaagaagtatgagttccactacgacaacgtgctgtgggccctgctgacgctc
ttcaccgtgtccacgggcgaaggctggccgcaggttctcaagcactccgtggatgccacc
ttcgagaaccagggtcccagccccgggtaccgcatggagatgtccatcttctatgtcgtc
tactttgtcgtgttccccttcttcttcgtcaatatctttgtggccttgatcatcatcacc
ttccaggagcaaggcgacaagatgatggaggaatacagcctggagaaaaatgagagggcc
tgcatcgacttcgccatcagcgccaaacctctgacccgacacatgccccagaacaagcag
agcttccagtaccgcatgtggcagtttgtggtgtctccgccttttgagtacaccatcatg
gccatgatcgccctcaacaccatcgtgctcatgatgaagttctatggggcctcgcttgct
tatgaaaacgctctgagggtgttcaacatcgtcttcacctccctcttctctctggaatgt
ctgctgaaagtcatggcttttgggattctgaattatttccgcgatgcctggaacatcttc
gactttgtgactgttctgggcagcatcaccgacatcctcgtcactgagtttgggaataac
ttcatcaacctgagcttcctccgcctcttccgagcagcccggctcatcaaactcctccgt
cagggttacaccatccgaattcttctctggacctttgtgcagtcgttcaaggcgctgccc
tacgtctgtctgctgattgccatgcttttcttcatctatgccatcatagggatgcaggtg
tttggcaacattggcattgacgtggaggacgaggacagtgaggaggacgacttccagatc
accgagcacaataacttccgcaccttcttccaggccctgatgctcctcttccggagtgcc
accggggaggcttggcacaacatcatgctttcctgcctcagtgggaaaccctgtgataaa
aactctggcatcctgactcccgagtgtggcaatgagtttgcttatttttacttcgtttcc
ttcatcttcctctgctcgtttctgatgctgaacctctttgtcgctgtcatcatggacaac
tttgagtacctcactcgagattcctccatcctgggtcctcaccacctggatgagtacgtg
cgtgtctgggctgagtacgaccctgcagcatggggccgcatgccttacccggacatgtat
cagatgctgagacacatgtctccgcccctgggtctggggaagaagtgtccggccagagtg
gcttacaagaggctcctgagaatggatctgcctgttgccgatgacaacactgtccacttc
aattctaccctcatggctctgatccgcacagccctggacatcaagattgccaagggaggg
gccgacaaacagcagatggacgccgagctccggaaagagatgatggccatctggcccaac
ctgtcccagaaaacactggacctgctggttacccctcataagtccaccgacctcacagtg
gggaagatctacgcagccatgatgatcatggagtactaccggcagagcaaagccaagaag
ctgcaggccatgcgtgaggagcagaaccggacacctctcatgttccagcgcatggagccc
ccgtcaccaacacaggagggggggcccggccagaatgccctcccctccacccagctggac
ccaggaggaagcctgatggctcacgaaagtggcatcaaggagagtccttcctgggtgacc
cagcgagcccaggagatgttccagaagacgggcacatggagcccggagcggggaccccct
accgacatgcccaacagccagcccaactctcagtctgtggaaatgcgagagatgggccga
gatggctactcagacagtgagcgctacctccccacggaaggccaggctcgggctgcctcc
atgccccgcctccctgcagaaaaccagaggagaaggggccggccacgtgggaataacctc
agtaccatctcagataccagccccatgaagcgctcagcctccgtgctgggccccaaggct
cggcgcctggatgactactctctagagagggtgcctcctgaagaaaaccagcggcaccac
cagcggcgccgagaccgtggccaccgagcctcggagcgctccttgggccgctacacggat
gtggacacaggcttggggacagatctgagtatgaccacccagtctggagacctgccatca
aaggagagggaccaggagcgtggcaggcccaaggaccggaagcaccggcagcaccatcac
caccaccaccaccaccacccccaacccccggacaaggaacgatatacccaggaacggcct
gaccaccgggcccgggccagggaccagcgctggtcccgttcacctagtgagggccccgag
cacatgacacaccggcaggtgggtgtggcaggagttgcccccagacccagccatggggga
ccaggaaaggagggtggcccctacaccccacagctactctgggcaggttcctcactcccc
accgtgacctctgaccctgcctaccattgggcttcttcccaagccaagggcggcctggac
acaggagtgcttgctggttataccaaaccctattattactgcctgcagaaaccgatttaa

KEGG   Miniopterus natalensis: 107541372
Entry
107541372         CDS       T05883                                 

Gene name
CACNA1F
Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent L-type calcium channel subunit alpha-1F
  KO
K04853  voltage-dependent calcium channel L type alpha-1F
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04270  Vascular smooth muscle contraction
mna04723  Retrograde endocannabinoid signaling
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04911  Insulin secretion
mna04912  GnRH signaling pathway
mna04921  Oxytocin signaling pathway
mna04924  Renin secretion
mna04925  Aldosterone synthesis and secretion
mna04927  Cortisol synthesis and secretion
mna04929  GnRH secretion
mna04934  Cushing syndrome
mna04935  Growth hormone synthesis, secretion and action
mna05010  Alzheimer disease
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05410  Hypertrophic cardiomyopathy
mna05412  Arrhythmogenic right ventricular cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107541372 (CACNA1F)
   04020 Calcium signaling pathway
    107541372 (CACNA1F)
   04024 cAMP signaling pathway
    107541372 (CACNA1F)
   04022 cGMP-PKG signaling pathway
    107541372 (CACNA1F)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107541372 (CACNA1F)
   04929 GnRH secretion
    107541372 (CACNA1F)
   04912 GnRH signaling pathway
    107541372 (CACNA1F)
   04921 Oxytocin signaling pathway
    107541372 (CACNA1F)
   04935 Growth hormone synthesis, secretion and action
    107541372 (CACNA1F)
   04924 Renin secretion
    107541372 (CACNA1F)
   04925 Aldosterone synthesis and secretion
    107541372 (CACNA1F)
   04927 Cortisol synthesis and secretion
    107541372 (CACNA1F)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107541372 (CACNA1F)
   04261 Adrenergic signaling in cardiomyocytes
    107541372 (CACNA1F)
   04270 Vascular smooth muscle contraction
    107541372 (CACNA1F)
  09156 Nervous system
   04727 GABAergic synapse
    107541372 (CACNA1F)
   04725 Cholinergic synapse
    107541372 (CACNA1F)
   04726 Serotonergic synapse
    107541372 (CACNA1F)
   04723 Retrograde endocannabinoid signaling
    107541372 (CACNA1F)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107541372 (CACNA1F)
   05020 Prion disease
    107541372 (CACNA1F)
   05022 Pathways of neurodegeneration - multiple diseases
    107541372 (CACNA1F)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107541372 (CACNA1F)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107541372 (CACNA1F)
   05414 Dilated cardiomyopathy
    107541372 (CACNA1F)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107541372 (CACNA1F)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107541372 (CACNA1F)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107541372 (CACNA1F)
SSDB
Motif
Pfam: Ion_trans CAC1F_C Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 107541372
NCBI-ProteinID: XP_016073872
LinkDB
Position
Unknown
AA seq 1910 aa
MSASEGRKGESSLPPLQTLXASLGSWQPFDILILLTIFANCVALGVYIPFPEDDSNTANH
NLEQVEYVFLVIFTVETVLKIVAYGLVLHPSAYIRNGWNLLDFIIVVVGLFSVLLEQGPG
RPGDAPHTGGKPGGFDVKALRAFRVLRPLRLVSGVPSLHIVLNSIMKALVPLLHIALLVL
FVIIIYAIIGLELFLGRMHKTCYFLGSDLEAEEDPSPCASSGSGRACTLNQTECRGRWAG
PNGGITNFDNFFFAMLTVFQCVTMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLN
LVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLRGYLDWITQAEELDSEDPSADGNF
GSVAEEGRAGHRPQLAELTNRRRGRLRWFSHSTRSTHSTNSHASLPASDTGSMAETPGDE
EEEEGALASCTRCLNKIMKTRVCHSLRRANRGLRACCRQAVKSNACYWAVLLLVFLNTLT
IASEHHGQPIWLTQTQEYANKVLLCLFTVEMLLKLYGLGPSTYVSSFFNRFDCFVVCGGI
LETTLVEVGAMQSLGISVLRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLLLLLFL
FIIIFSLLGMQLFGGKFNFDQTHTKRSTFDTFPQALLTVFQILTGEDWNVVMYDGIMAYG
GPFFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLASGDAGTAKNKGREKSTEGKPPQE
NGALVPGGENEEEEGAKNAGAGMEEEEEEEEEEEEEGAGRVELLQEVVPKEKVVPIPEGS
AFFCLSQTNRMRTACHTLIHHHVFTNLILVFIILSSVSLAAEDPIRAHSFRNHILGYFDY
AFTSIFTVEILLKMTVFGAFLHRGSFCRSWFNLLDLLVVSVSLISFGIHSSAISVVKILR
VLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYSC
TDEAKHTPQECKGSFLIYPDGDVSRPLVRERLWVNSDFNFDNVLSAMMALFTVSTFEGWP
ALLYKAIDAHAEDQGPIYNYHVEISVFFIVYIIIIAFFMMNIFVGFVIITFRAQGEQEYQ
NCELDKNQRQCVEYALKAQPLRRYIPKNPHQYRVWATVNSAAFEYLMFLLILLNTVALAM
QHYEQTAPFNYAMDILNMVFTGLFTVEMVLKIIAFKPKHYFADAWNTFDALIVVGSIVDI
AVTEVNNGGHLGESSEDSSRISITFFRLFRVMRLVKLLSKGEGIRTLLWTFIKSFQALPY
VALLIAMIFFIYAVIGMQMFGKVALQDGTQINRNNNFQTFPQAVLLLFRCATGEAWQEIM
LATLPGNRCDPESDFGPGEEFTCGSNFAIAYFISFFMLCAFLIINLFVAVIMDNFDYLTR
DWSILGPHHLDEFKRIWSEYDPGAKGRIKHLDVVALLRRIQPPLGFGKLCPHRVACKRLV
AMNMPLNSDGTVTFNATLFALVRTSLKIKTEGGNLEQANQELRIVIKKIWKRLKQKLLDE
VIPPADEDEVTVGKFYATFLIQDYFRKFRRRKEKGLLGTEAPPSTSSVLQAGLRSLQDLI
PEIRQALSCDTEEEEEEGQEREEKEDEKDPETYQALMGSQPPSRRSSISVSLPTGDKLPD
SLSSGPSDDNVGAPNSRQSSVPQAGSHARRRSSGALIFTIPEEGSFQPRGTEGQAKQYEE
EEVLGQLSLDEPAGTPPRPILLPPHRPQRYLDGHHAPCRRLLPPTPTPAGQKPSFTIQCL
RRQGSCEDLPIPGTYHRGHNSGPSKAQGSWATPPQRGRLLYAPLLLVEEGAPGMHSLSKS
SGGPLFTFTCLQVPGTHSDHSHGKRGSADSLVEAVLFSEGLDIFARDPRFVALAKQEIAD
ACRLTLDEMDSAASDLLAQGTSSLYSDEESILSRFDEEDLGDEMACVHAL
NT seq 5733 nt   +upstreamnt  +downstreamnt
atgtcggcatctgaaggcaggaaaggtgagagcagccttccacccctgcagaccctttga
gcaagcctgggctcttggcagcccttcgacatcctcatcctgctgaccatctttgccaac
tgcgtggccctgggggtctacattcccttcccagaagacgactccaacactgccaaccac
aacctggaacaggtggagtacgtatttctggtgattttcactgtggagacggtgctcaag
atcgtggcctacgggctggtgctccatcctagcgcctacatccgcaatggctggaaccta
ctcgacttcatcatcgttgtggtcgggttgttcagcgtactactggaacagggccccgga
cggcctggggacgctccgcacactggggggaagccagggggctttgatgtgaaggctttg
cgggcatttcgggtgttgcggccactgaggctggtgtctggggtcccgagcctgcacata
gtgctcaattccatcatgaaggcgctggtgccgctgctgcacatcgccctactcgtgctc
ttcgtcatcattatttatgccatcatcggactcgagctgttcctcggacgcatgcacaaa
acgtgctacttcctgggatcggacttggaagccgaggaggacccatcgccctgtgcatct
tctggctccgggcgtgcgtgcaccctgaaccagaccgagtgccgcgggcgctgggcaggg
cccaatggaggcatcactaacttcgacaacttcttcttcgccatgctgacggtcttccaa
tgtgtcaccatggaaggctggaccgacgtgctctactggatgcaggatgccatggggtat
gagctgccctgggtgtatttcgtgagtctcgtcatctttgggtccttctttgtcctcaac
cttgtacttggcgtcctgagtggggagttctccaaggagagagagaaggcaaaagcacga
ggggacttccagaagctgcgggagaagcagcagttggaggaggacctgcggggctatctg
gactggatcacacaggcagaggagctggacagtgaagacccctcagctgatggcaacttt
ggttctgtggctgaagagggcagggctggccacaggccacaactggcagagctgaccaat
aggagacgtggacgtctgcgttggttcagtcactccacccgctccacacattccaccaac
agccatgccagcctgccagccagtgacaccggttcgatggcagagacgccaggagatgag
gaagaggaggagggggctctggcgagttgtacacgctgcctaaacaagatcatgaaaacc
agggtctgccacagcctccgtcgagccaaccggggccttcgggcatgctgccggcaagct
gtgaagtccaatgcgtgttactgggctgtgctgctgctcgttttcctcaacacactgact
atcgcttcagagcaccacgggcagcccatatggctcacccagacccaggaatatgccaac
aaagtgttgctctgtctgttcacggtggagatgcttctcaagttgtacggtctgggcccc
tccacctacgtttcctccttcttcaaccgttttgactgctttgtggtctgtgggggcatc
ctggaaaccacactggtggaggtgggcgccatgcagtccctggggatctcagtgctccga
tgtgtgcgtcttctcaggatctttaaggtcactaggcactgggcatctctgagcaatttg
gtggcatccctgctcaattcaatgaaatccatcgcgtccttgctgcttctcctcttcctc
tttatcatcatcttctccctgcttggcatgcagctgtttgggggcaagttcaactttgac
cagacccacaccaagcgaagcacctttgacactttcccccaggccctcctcactgtcttt
cagatcctgacaggtgaggactggaacgtggtaatgtatgatggtatcatggcttacggc
ggccccttcttcccagggatgctggtgtgcatctatttcatcattctcttcatctgcggc
aactacatcctgttgaatgtgtttcttgccattgctgtggacaacctagccagtggagat
gcaggcactgccaagaacaagggcagggagaagagcactgaagggaaacccccacaggaa
aatggagcattggtgcctggtggggagaatgaagaagaggagggtgcaaagaatgcagga
gcaggaatggaggaagaggaggaagaggaagaagaggaggaggaagagggtgcagggcgt
gtggaactcctacaggaagttgtacccaaggagaaggtggtgcccatccctgagggcagc
gccttcttctgcctcagccaaaccaaccgaatgaggacggcttgtcacaccctcatccac
catcacgtcttcaccaatcttatcctggtgttcatcattctcagcagtgtatccctagct
gctgaggaccccatccgagcgcactccttccgcaaccacattctggggtacttcgactat
gccttcacctccattttcactgtggagattctactaaagatgacggtgttcggggccttc
ctgcacagaggctccttctgccgtagttggttcaatctcttggatctgctggtagtcagt
gtgtctctcatctcttttggcatccactccagtgccatctcagtagtaaagattctgcga
gtactccgagttcttcggccccttcgagccatcaaccgggccaagggactcaagcacgtg
gtacagtgtgtgttcgtggccatccggaccatcgggaatatcatgattgtaaccacactc
ctgcaattcatgtttgcctgcattggtgtacagctcttcaaggggaaattctacagttgc
actgatgaggccaaacacacaccccaagaatgcaagggctccttcctgatttatcctgat
ggagatgtgtcacggcccctggtccgggagcggctctgggtcaacagcgatttcaacttt
gacaatgtcctttcagccatgatggctctgttcactgtctccacctttgaaggctggcct
gcgctgctatacaaggccattgatgcacatgcagaggaccagggccccatctataattac
cacgtggagatatcagtgttcttcattgtttatatcatcatcatcgcattcttcatgatg
aacatctttgtgggctttgtcatcatcaccttccgtgcccagggggagcaggaataccaa
aactgtgagctggacaagaaccagcgccagtgcgtggagtatgccctcaaggcccagcca
ctccgccgttacatccccaagaacccacaccagtatcgtgtatgggccactgtgaactct
gctgcctttgagtacctcatgttcctgctcatcctgctcaacactgttgctctagccatg
cagcactatgagcagactgctcccttcaactatgccatggacatcctcaatatggtcttc
actggcctctttactgttgagatggtgctcaaaatcatagccttcaaacctaagcattac
tttgctgatgcctggaacacatttgatgctcttattgtggtgggcagcatagtggacatt
gctgtcactgaagtcaacaatggtggccatcttggcgagagctctgaggacagttcccga
atttccatcaccttctttcgcctcttccgagtcatgcgactggtcaagcttctcagcaag
ggtgaagggatccgcacattactctggacattcatcaagtccttccaggccttgccctat
gttgctcttctcatcgcaatgatattcttcatttatgcagtcattgggatgcaaatgttt
ggcaaggtggctcttcaggatggcacacagatcaaccgaaacaacaactttcagactttt
ccacaggctgtgctgcttctgttcaggtgtgccactggtgaggcatggcaagagataatg
cttgccacccttcccgggaatcgatgtgaccctgagtctgacttcggccctggcgaggag
tttacctgtggtagcaattttgccatcgcctattttattagcttcttcatgctctgtgcc
ttcctgattataaatctctttgtggctgtgatcatggacaactttgattatttaaccaga
gattggtccatcctgggcccccatcacctcgatgaattcaagaggatctggtctgaatat
gaccctggggccaaaggccgcattaaacacctggatgtggttgccctgctgagacgtatc
cagccaccactgggatttgggaagctgtgcccacaccgagtggcctgcaagagacttgtg
gcgatgaacatgcccctcaactcagatgggacggtaacattcaacgccacactctttgcc
ctggttcggacatccctgaagatcaagacagaaggagggaacctggagcaagccaatcag
gagctgcggattgtcatcaaaaagatctggaagcggctgaagcagaagctgctagatgag
gtcatcccccctgccgatgaggacgaggtcaccgtgggcaaattctatgccacatttctg
atccaggactatttccgcaaattccggcggaggaaagaaaaggggcttctagggaccgag
gcccccccaagcacctcctctgtccttcaggctggtctgaggagcctacaggacttgatt
cctgagatccgacaggccctaagctgtgacacagaggaggaggaggaggaggggcaggag
agagaggagaaggaagatgagaaggacccagaaacataccaagccctgatgggatcccag
cccccatctcgtaggagctccatttctgtgtctctgcctactggggacaaacttccagat
tcactctcctctgggcccagtgatgacaatgtgggggctcccaactccagacagtccagt
gtgccccaggctggatcccatgcccgcaggagaagttctggggctctcattttcaccatt
ccggaagaaggaagttttcagcccaggggaactgaagggcaggccaaacagtatgaggaa
gaagaagtcctgggccagctctccttagatgagccggcagggactcccccacgccccatc
cttttgccacctcacagaccccagaggtacctggatgggcaccatgcaccatgccgccgt
ctgctgcccccaacaccaacacctgcaggtcagaagccctccttcaccatccagtgtttg
cggcgccagggaagttgtgaagatttacccatcccaggcacctatcatcgtgggcacaac
tcagggcccagcaaggcacagggttcctgggcaacccctcctcagcggggtcggctcctg
tacgccccgctgctattggtggaggagggtgcaccagggatgcactccctcagcaagtcc
agcggcggtccgcttttcacctttacctgtctgcaagtgcctggaacccactcggaccac
agccatggcaagaggggcagtgctgacagcctggtggaggctgtgctcttctctgagggc
cttgacatctttgcccgagatccgcgcttcgtggccctggccaagcaggagatcgcggat
gcgtgtcgcctgacactggacgagatggacagtgctgccagtgacctgctggcacaggga
accagctcactttatagtgacgaagaatccatcctctcccgctttgatgaagaagacctg
ggagatgagatggcctgtgtccatgccctctga

KEGG   Miniopterus natalensis: 107546425
Entry
107546425         CDS       T05883                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04270  Vascular smooth muscle contraction
mna04713  Circadian entrainment
mna04720  Long-term potentiation
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04742  Taste transduction
mna04911  Insulin secretion
mna04912  GnRH signaling pathway
mna04921  Oxytocin signaling pathway
mna04924  Renin secretion
mna04925  Aldosterone synthesis and secretion
mna04927  Cortisol synthesis and secretion
mna04929  GnRH secretion
mna04930  Type II diabetes mellitus
mna04934  Cushing syndrome
mna04935  Growth hormone synthesis, secretion and action
mna05010  Alzheimer disease
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05031  Amphetamine addiction
mna05410  Hypertrophic cardiomyopathy
mna05412  Arrhythmogenic right ventricular cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107546425 (CACNA1C)
   04020 Calcium signaling pathway
    107546425 (CACNA1C)
   04024 cAMP signaling pathway
    107546425 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    107546425 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107546425 (CACNA1C)
   04929 GnRH secretion
    107546425 (CACNA1C)
   04912 GnRH signaling pathway
    107546425 (CACNA1C)
   04921 Oxytocin signaling pathway
    107546425 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    107546425 (CACNA1C)
   04924 Renin secretion
    107546425 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    107546425 (CACNA1C)
   04927 Cortisol synthesis and secretion
    107546425 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107546425 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    107546425 (CACNA1C)
   04270 Vascular smooth muscle contraction
    107546425 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    107546425 (CACNA1C)
   04727 GABAergic synapse
    107546425 (CACNA1C)
   04725 Cholinergic synapse
    107546425 (CACNA1C)
   04728 Dopaminergic synapse
    107546425 (CACNA1C)
   04726 Serotonergic synapse
    107546425 (CACNA1C)
   04720 Long-term potentiation
    107546425 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    107546425 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    107546425 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107546425 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107546425 (CACNA1C)
   05020 Prion disease
    107546425 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    107546425 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    107546425 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107546425 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107546425 (CACNA1C)
   05414 Dilated cardiomyopathy
    107546425 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107546425 (CACNA1C)
   04934 Cushing syndrome
    107546425 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107546425 (CACNA1C)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107546425 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel DUF4834
Other DBs
NCBI-GeneID: 107546425
NCBI-ProteinID: XP_016080296
LinkDB
Position
Unknown
AA seq 1929 aa
MVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIAAEDDPSPCALETGHGRQCQ
NGTVCKPGWDGPRHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVT
LIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDI
DPENEDEGMDEEKPRNRGAPAGLLDQKKGKFAWFSHSTETHVSMPTSETESVNTENVAGG
DIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIA
SEHYNQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILE
TILVETKVMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFI
IIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGP
SFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARPA
RTASPEKKQEAVEKPTVEETKEEKIELKSITADGESPPTTKINVDDLQPNENEDKSVYPN
PETTGEEEEEEPEMPVGPRPRPLSELHLKEKAAPMPEASAFFIFSPTNRFRLQCHRIVND
SIFTNLILFFILLSSISLAAEDPVQHTSFRNHILFYFDIVFTTIFTIEIALKMTAYGAFL
HKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVV
QCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYKDG
EVDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYR
VEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPL
RRYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCLFKIAMNILNMLFT
GLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNHYFCDAWNTFDALIV
VGSIVDIAITEVNPTEHTQCSPFMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLW
TFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFR
CATGEAWQDIMLACMPGKKCAPESEPHNSTEGETPCGSSFAVFYFISFYMLCAFLIINLF
VAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFG
KLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKK
IWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSL
QAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVSYYQ
SDSRSAFPQTFTTQRPLHINKATNSPGDTESPSHEKLVDSTFTPSSYSSTGSNANINNAN
NTALGRFPRPTGYPSTVSAVEGHGPPLSPAIRVQEASWKLSSKRCHSRESQIAMVCREEF
SQDETYDVRMGEDAEYCSEPSLVSTEKLSYQDDENRQLTPPEEDKRDIRQSPKRSFLRSA
SLGRRASFHLECLKRQKHQGGDISQKTVLPLHLVHHQALAVAGLSPLLQRSHSPTTFPRP
CATPPAMPGSRGWPPQPIPTLQLEGTESSEKLNSSFPSVHCSSWSVEPTPCEGGSSATRR
ARPVSLTVPGQAGAWGRQFHGSASSLVEAVLISEGLGQFAQDPKFIEVTTQELADACDMT
IEEMENAADNILSGGAQQSPNGTLLPFVNCRDRGQDRAGGEEDGPCGPSQECRRSEEELQ
DSRAYVSSL
NT seq 5790 nt   +upstreamnt  +downstreamnt
atggtccccctgctgcacatcgccctgctagtgctgttcgtcatcatcatctacgccatc
attggcctggagctcttcatggggaagatgcataagacctgctacaaccaggagggcata
gcagcagaagatgacccctccccttgtgctctggagacgggccacgggcggcagtgtcag
aatggcactgtgtgcaagcccggctgggacgggcccaggcacggcatcaccaacttcgac
aacttcgccttcgccatgctgacggtgttccagtgcatcaccatggagggctggacggac
gtgctgtactgggtcaatgatgccgtaggaagggactggccctggatctattttgttaca
ctaatcatcatagggtcattttttgtacttaacttggttctcggtgtccttagcggagag
ttctccaaagagagggagaaggccaaggctcggggagatttccaaaagctgcgagagaag
caacagctggaagaggacctgaaaggctatctggactggatcacacaggcggaagacatc
gaccccgagaatgaagatgaaggcatggatgaggagaaaccccgaaacagaggagctcca
gcaggcttgctcgatcagaagaaagggaagtttgcttggtttagtcactccacagaaacc
catgtgagcatgcccacaagtgagacggagtctgtcaacactgagaacgtggctggcggt
gacatcgagggagaaaactgtggggccaggctggcccaccgaatctccaagtcgaagttc
agtcgctactggcgccggtggaatcggttctgcagaagaaagtgtcgcgccgcagtcaag
tccaacgtcttctactggctggtgattttcctggtgttcctcaacacgctcaccattgcc
tcagagcattacaaccagcctcactggctcacagaagtccaagacacggccaacaaggca
ctcctggcccttttcactgcagagatgctgctgaagatgtacagcctgggcctgcaggcc
tacttcgtgtccctcttcaaccgcttcgactgcttcatcgtgtgcggaggcatcctggag
accatcctggtggagaccaaggttatgtctcccttgggcatctctgtgctgagatgcgtt
cggctcctgaggatatttaaaatcaccaggtactggaactccttaagcaacctggtagca
tccttgctgaactccgtgcgctccatcgcctccctgctgctgctcctcttcctcttcatc
atcatcttctccctcctggggatgcagctcttcggaggaaagttcaactttgatgagatg
cagacccggaggagcacatttgataacttcccccagtccctcctgaccgtgtttcagatc
ctgaccggggaggactggaattcggtgatgtatgatgggatcatggcttatggcggcccc
tcttttccagggatgttagtctgtatttacttcatcatcctcttcatctgtggaaactat
atcctactgaatgtgttcttggccattgctgtggacaacctggctgatgctgagagcctc
acatctgcccaaaaggaggaagaagaagaaaaggagagaaagaagctggccagaccggcc
aggactgccagcccagagaagaaacaggaggcggtggagaagccgacagtggaggagacc
aaggaggagaaaatcgagctgaaatccatcacagctgacggagagtccccacccaccacc
aagatcaacgtggatgacctgcagcccaatgaaaatgaggacaagagtgtctaccccaac
ccagaaacgacaggagaagaggaggaggaggagcctgagatgcctgtgggccctcgccca
cgccctctctctgagctgcaccttaaggaaaaggcagcgcccatgcctgaagccagtgca
tttttcatcttcagccccaccaacaggtttcgcctccagtgccaccgcattgtcaatgac
tcgatcttcaccaatctgatcctcttcttcatcctgctcagcagcatttccctggctgct
gaggaccccgtccagcacacctccttcaggaaccatattctgttttattttgatattgtt
tttactaccattttcaccattgaaattgctctgaagatgactgcttatggggctttcttg
cacaagggctccttttgccggaactacttcaacatcttggacctgctagtggtcagcgtg
tccctcatctcctttggcatccagtccagtgcaatcaacgtcgtaaagatcttgcgagtt
ctgcgagtactcaggcccctgagagccatcaacagagccaagggactaaagcatgtggtc
cagtgtgtgtttgtcgccatccggaccattggcaacatcgtgattgtcaccacactgctt
cagttcatgttcgcctgcatcggggtccagctcttcaagggaaagctctacacctgttca
gacagctccaagcagaccgaggcagaatgcaagggtaactacattacatacaaggacggg
gaggttgaccaccccatcatacagccccgcagctgggagaacagcaagtttgactttgac
aatgtcctggcagccatgatggctctcttcacggtctccacctttgaggggtggccagag
ctgctgtaccgctccatcgactcccacacggaagacaagggccccatctacaactaccgc
gtggagatctccatcttcttcatcatctacatcatcatcattgccttcttcatgatgaac
atcttcgtgggtttcgtcatcgtcaccttccaggaacagggagagcaggagtacaagaac
tgtgagctggacaaaaaccagcgacagtgtgtggaatacgccctgaaggcccggcccctg
cggaggtacatacccaagaaccagcaccagtacaaagtgtggtatgtggtcaactccacc
tacttcgagtacctgatgttcgtactcatcctgctcaacaccatctgcttggccatgcag
cactacggtcagagctgcctgtttaaaatcgccatgaacatcctcaacatgctcttcact
ggcctcttcactgtggagatgattctgaagcttattgcctttaaacccaagggttacttt
agtgatccctggaatgtttttgacttcctcatcgtaattggcagcataattgacgtcatt
ctcagtgaaactaatcactatttctgtgatgcatggaatacgtttgacgccttgattgtt
gtgggtagcattgttgatatagcaatcaccgaggtaaacccaactgaacatacccaatgc
tctccctttatgaacgcagaggagaactcccgcatctccatcaccttcttccgcctcttc
cgggtcatgcgcctggtcaagctgctgagccgtggggagggcatccggaccctgctgtgg
accttcatcaagtccttccaggccctgccctacgtggcccttctcatagtgatgttgttc
ttcatctatgccgtgatcgggatgcaggtgtttgggaaaattgccctgaacgacaccacg
gagatcaaccggaacaacaactttcagaccttcccccaagctgtgctgctcctcttcagg
tgtgccactggggaggcgtggcaggacatcatgctggcctgcatgccagggaagaagtgc
gccccggagtctgagccccacaacagcacggaaggggagacgccctgtggcagcagcttc
gccgtcttctacttcatcagcttctacatgctctgtgccttcctgatcatcaacctcttt
gtagctgtcatcatggacaactttgactacctgacaagggactggtcaatccttggtccc
caccatctggacgaatttaaaagaatctgggcagagtatgaccctgaagccaagggtcgc
atcaaacacctggatgtggtgaccctgctccggcggattcagcccccactgggttttggg
aagctgtgccctcaccgtgtggcttgcaaacgtctggtctccatgaacatgcctctgaac
agtgatgggacggtcatgttcaatgccaccctatttgccctggtccggacagccctgagg
atcaaaacggaagggaacctggaacaagccaatgaggagctccgggccataatcaagaag
atctggaagcggaccagcatgaagctgctggaccaagtggtgccccccgcgggtgatgat
gaggtcacagttggcaagttttatgctactttcctgatccaagagtacttccggaaattc
aagaagcgcaaggagcagggcctcgtgggcaagccctcccagaggaacgccttgtccctg
caggctggcttgcgcacgctgcacgacatcgggcctgagatccgacgggccatctccgga
gatctgacagctgaggaggagctggacaaagccatgaaggaggctgtgtctgctgcctct
gaagatgacatcttcaggagggccggtggcctgttcggcaaccatgtcagctactaccaa
agcgacagccggagcgccttcccccagaccttcaccacccagcgcccactgcacatcaac
aaggccactaacagcccaggcgacaccgagtctccgtcccacgagaaattggtggactcc
accttcacccccagcagctactcatccactggctccaacgccaacatcaacaatgccaac
aacactgccctgggccgctttccccgccccaccggctaccccagcaccgtcagtgctgtg
gagggccacgggccccccttgtctcctgccatccgggtgcaggaggcttcgtggaagctc
agctccaagaggtgccactcccgggagagccagatagccatggtgtgtcgggaggagttt
tctcaggacgagacctatgacgtgaggatgggtgaagacgcagagtactgcagtgagccc
agcctggtctccacagagaagctctcctatcaggatgatgaaaaccgacaactgacaccc
ccagaggaggacaagagggacatccggcagtctccaaagaggagcttcctccgctctgcc
tccctaggtcgaagggcctccttccacctggaatgtctaaagcgacagaagcatcaaggg
ggagacatatctcagaagacagtcctgcccttacatctggttcatcaccaggcattggca
gtggcaggcctgagccccctcctccagagaagccattctcccaccaccttccccaggcca
tgtgccacgccccctgccatgcccggcagccgaggctggcccccgcagcccatccccacc
ctgcagctcgaaggaaccgagtccagcgagaaactcaacagcagcttcccgtccgtccac
tgcagctcctggtccgtggagcccacgccttgtgagggtggcagcagcgccacccggaga
gcccggcctgtgtccctcactgtgcccggccaggcgggtgcctggggcaggcagttccac
ggtagcgccagcagtctggtggaagcggtcttgatttcggaaggactggggcagtttgcc
caagatcccaagtttatcgaggtcacaacccaggagctggctgacgcctgtgacatgacc
atagaggagatggagaacgctgctgacaacatcctcagtgggggcgcccagcagagcccc
aacggcaccctattaccttttgttaactgcagggaccgggggcaggacagagcagggggc
gaagaggacgggccctgtgggcccagccaggagtgccggaggagcgaggaggagctgcag
gacagcagagcctacgtcagcagcctgtag

DBGET integrated database retrieval system