KEGG   Miniopterus natalensis: 107535074
Entry
107535074         CDS       T05883                                 

Gene name
PDE8B
Definition
(RefSeq) high affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8B
  KO
K18437  high affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8 [EC:3.1.4.53]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna01100  Metabolic pathways
mna04927  Cortisol synthesis and secretion
mna04934  Cushing syndrome
mna05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107535074 (PDE8B)
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    107535074 (PDE8B)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107535074 (PDE8B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107535074 (PDE8B)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     107535074 (PDE8B)
SSDB
Motif
Pfam: PDEase_I PAS_9 PAS PAS_3 PAS_4 PAS_8
Other DBs
NCBI-GeneID: 107535074
NCBI-ProteinID: XP_016065879
LinkDB
Position
Unknown
AA seq 777 aa
MFSAYKVSSAEVRIGPMRLTQDPVQVLLIFAKEDSQSDGFWWACDRAGYRCNITRTPESA
LECFLDKHHEIIVIDHRQARNFDAEAVCRSIRATNLSEHTVILAVVSQASGDHEEASVLP
LLHAGFNRRFMENSSILACYNELIQIEHGEVRSQFKLRACNSVFTALDHCHEAIEITSDE
HVIQYVNPALERMMGYHKGELLGKELAELPKSDKNRADLLDTINTCIRKGKEWQGVYYAK
RKSGDSIQQHVKITPVIGQGGKIRHFVSLKKLCCTTDNNKQIHKIHRDSGDNSQTESHSF
RYKNRRRESIDVKSISSRGSDAPSLQNRRYPSMARIHSMTIEAPITKVINIINAAQENSP
VTVAEALDRVLEILRTTELYSPQLGTKDEDPHTSDLVGGLMTDGLRRLSGNEYVFTKNVH
QSHSHLAMPITINDVPPCIAQLLDNEESWEFNIFELEAVTHKRPLVYLGLKVFSRFGVCE
FLRCSETTLRAWLQVIEANYHSSNAYHNSTHAADVLHATAFFLGKERVKGSLDQLDEVAA
LIAATVHDVDHPGRTNSFLCNAGSELAVLYNDTAVLESHHTALAFQLTVKDSKCNIFKNI
DRNHYRTLRQAIIDMVLATEMTKHFEHVNKFVNSINKPMAAEMEGSECECSPTGKNFPEN
QILIKRMMIKCADVANPCRPLDLCIEWAGRISEEYFAQTDEEKRQGLPVVMPVFDRNTCS
IPKSQISFIDYFITDMFDAWDAFAHLPALMQHLSNNYKHWKTLDDLKCKSLRLPSDS
NT seq 2334 nt   +upstreamnt  +downstreamnt
atgtttagtgcatataaggtttcttctgcggaggtgcgcattgggcccatgagactgaca
caggatcctgtccaggttttgctgatctttgccaaggaggatagtcagagtgatggattc
tggtgggcctgtgacagagccggttacagatgcaacatcacccggaccccggagtccgcc
ctggaatgctttctagataaacatcacgaaattattgtgatcgatcacagacaagctcga
aactttgatgcagaagctgtgtgcaggtcgatccgggccacgaatctctcagagcacacg
gtgatcctcgcggtggtttcacaagcatcaggcgaccatgaagaggcctcagtcctcccg
cttctgcacgcaggcttcaacaggagatttatggagaatagcagcatccttgcttgctat
aacgaactgattcaaatagagcacggggaagttcgctcacagttcaaattacgggcctgt
aattcagtgtttacggcattagaccactgtcatgaagccatagaaataacaagcgatgag
catgtgattcagtatgtcaacccagccttggaaaggatgatgggctaccacaagggcgag
ctcctggggaaggaacttgcggagctgcccaaaagcgataagaaccgggcagacctcctg
gacaccatcaacacgtgcatcaggaagggcaaggagtggcaaggggtttactacgccaaa
cggaagtctggggacagcatccaacagcatgtgaagatcaccccagtgatcggccaaggc
gggaaaattaggcattttgtctccctcaagaaactgtgttgtaccactgacaataataag
cagatccacaagattcatcgtgattctggagacaattctcagacagagtctcattcattc
agatacaagaacaggaggagagagtccattgatgtgaaatcaatatcatctcgaggcagt
gatgcaccaagcctacagaatcgtcgctatccatccatggcaaggatccattccatgacc
atcgaggctcccatcacaaaggttataaatataatcaacgcagcccaagaaaatagcccg
gtcacagtagcagaagccttggacagagttttagaaattttacggaccacagaactgtac
tccccacagctgggtaccaaagatgaagatcctcacaccagtgatctcgtcggaggcctt
atgactgatggcttgagaaggttgtcagggaacgagtatgtgttcactaagaacgtgcac
cagagtcacagtcaccttgcgatgccaataaccatcaacgacgtccccccttgtatcgct
cagttacttgataatgaggaaagttgggagttcaacatctttgagttggaggctgttaca
cataaaaggccgttggtttacctgggcttaaaggtcttttcccggttcggagtatgtgag
tttttacgctgttctgaaactactcttcgggcctggctccaagtgattgaagccaactac
cactcctccaatgcttaccacaactccacacacgccgcggacgtcctgcatgccacggcc
ttcttcctgggaaaggagagagtgaagggaagcctggatcagctggatgaggtggccgcc
ctgattgctgccacagtccatgacgtggatcacccgggaaggaccaactctttcctctgc
aatgcaggcagtgagcttgctgtgctctacaatgacacagctgtcctggagagccaccac
accgccctggccttccagctgaccgtcaaggacagcaagtgcaacattttcaagaacatt
gacaggaaccattatcgaacactgcgccaggctattattgacatggttttagcaacagag
atgacaaaacactttgagcatgtgaacaagtttgtgaacagcatcaacaagccaatggca
gcggagatggagggcagtgagtgcgagtgcagccctactgggaagaacttccccgagaac
cagatcttgatcaagcgcatgatgatcaagtgcgccgacgtggccaacccgtgccggccc
ctggacctgtgcatcgaatgggccgggcgcatctcggaggagtacttcgcgcagactgat
gaagagaagagacagggactgcctgtggtgatgccagtgtttgaccggaacacctgcagc
atccccaagtcacagatctccttcattgactacttcataacagacatgtttgacgcctgg
gatgcctttgcacatctgccagccctgatgcaacatttatccaataactacaaacactgg
aagacattagatgacctgaagtgcaaaagtctgaggcttccatctgacagctaa

KEGG   Miniopterus natalensis: 107539243
Entry
107539243         CDS       T05883                                 

Gene name
PDE8A
Definition
(RefSeq) high affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A
  KO
K18437  high affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8 [EC:3.1.4.53]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna01100  Metabolic pathways
mna04927  Cortisol synthesis and secretion
mna04934  Cushing syndrome
mna05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107539243 (PDE8A)
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    107539243 (PDE8A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107539243 (PDE8A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107539243 (PDE8A)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     107539243 (PDE8A)
SSDB
Motif
Pfam: PDEase_I PAS_9 PAS PAS_4 PAS_3 PAS_8 UBA_e1_thiolCys
Other DBs
NCBI-GeneID: 107539243
NCBI-ProteinID: XP_016071153
LinkDB
Position
Unknown
AA seq 757 aa
MRFHPDQLQVLLVFTKDDNQCKGFRKACEKAGFKYTVTREAKAVLACFLATLHDIIIIDY
RSPRQLDAELLCRSIRSYKASENTVIVGVVRKRDGDENSILPLIAAGFTRRYVENPSLLA
CYTELLQLEFGEVRSQLKLRACNSVFTALEKSQDAIEITSEDHLIQYANPAFETIMGYES
GELIGKELEKMPINEKKADLLDTINSCIKKGKEWKGVYYAKNGDNVQQNVNIIPVVGQGG
KIRHYVSIIRVSNGNNKAEKTTERVRSDTHADHQSGKHKDKRKSSLDVRSVASRASEVAS
QRRHSSMARIHSLTVETPITKVINIINAAQENSSVTVTEALDRVLEILRSTELYSPQFGA
KDDDPHANDLVGGLISDGFRRQSGNEYVLSTKALQQIPSGLILPMSLQDVPPPIAQAMEN
EQFWDFDIFKLEAATQKRPLTFLGLKIFTRFGICEFLNCSETTLRSWLQIIEANYRSSNP
YHNSTHAADVLHATAYFLCRNRIKQTLDSVDEAAALIAAAIHDLDHPGRTNPFLCNSGSE
LAILYNDIAVLESHHAALAFQLSTRDDKCNIFKNMERNDYRTLRQIIIDMVLATEMTKHF
EHFNKFVNSINKPLAELEENEEAEKDQEAINALLRTPENRTLIKRMMIKCADVSNPCRAL
EQCIEWAARISEEYFSQTDEEKQQDLPVVMPAFDRKTCSIPKSQISFIDYFITAMFDAWD
AFVDLPELLQNLDNNFKYWKGLDEMKLRGLRPPLEPE
NT seq 2274 nt   +upstreamnt  +downstreamnt
atgagatttcatccagatcaactccaggtacttttggtgtttaccaaagacgacaaccag
tgtaaagggttccgtaaggcgtgcgaaaaggcagggttcaagtacacggttaccagggag
gcgaaggctgtgcttgcctgtttcctggctacacttcatgacatcatcatcatagactac
aggtccccccgacagttggatgcggagttgctatgcaggtctattcgatcatacaaagcc
tcagaaaacacagttatcgttggtgtggtacgcaagcgggatggagacgagaactccatt
ttacctctcatcgctgctggctttacgaggaggtatgtggaaaacccaagcctcctggcc
tgttacacagagctactccagctggagtttggagaggtgcgatcacagctgaaactcagg
gcctgcaactcagtattcaccgcgttagagaaaagccaagatgccattgaaattacaagt
gaggatcacctgattcagtatgccaatcctgcattcgaaacaataatgggctacgagtca
ggtgaattaataggaaaggagttagaaaagatgcctataaatgaaaaaaaggctgatttg
ctcgataccataaattcatgcatcaagaagggcaaggagtggaaaggcgtttactatgcc
aagaacggagacaacgtacagcaaaatgtgaacataatccctgtcgtcgggcagggagga
aaaattagacactatgtgtccattatcagagtgtccaatggcaacaataaggctgagaaa
acaaccgaacgtgttcggtctgacactcacgcagatcatcagtcaggtaaacataaagac
aagagaaaaagctcactagacgtcaggagtgttgcctctcgagcaagtgaagtggccagc
cagagacgacactcctccatggcccggatccattctttgactgtcgagacgcccatcacc
aaggtaatcaatatcatcaatgctgcccaggaaaacagctccgtgactgtcacagaagcc
ttagaccgcgtgctggaaattctaaggtccaccgagttgtactcaccacagttcggtgct
aaagatgatgatcctcacgccaatgacctcgttgggggcctgatatctgatggttttcga
agacaatctgggaatgagtatgttctgtcaacaaaagcccttcagcaaattccaagcggt
ttaatcctgcccatgtccctgcaagatgtcccgccgccgattgcgcaggccatggagaac
gagcagttctgggactttgatatttttaaactggaggctgccactcagaaaaggccttta
actttcctcggtctcaaaatctttactcgctttggaatctgtgaattcttaaactgctct
gagacaacgctgaggtcgtggctgcaaattatcgaggccaattaccgctcttctaacccc
taccacaattccacacacgctgcagacgtgctccacgccaccgcctatttcctgtgcaga
aacaggataaagcaaactttagattctgttgatgaggctgctgccctcattgcagccgcc
atccatgacctggaccaccctgggagaaccaaccccttcctgtgcaactctgggagtgag
ctggccattctgtacaatgacatcgccgtgctggagagtcaccacgcggccctggccttc
cagctgagcacgagagacgataaatgtaacatcttcaaaaacatggagaggaatgactac
cggacgctgcgccagatcatcatcgacatggtcttggccacggagatgacgaagcacttc
gagcacttcaacaagtttgtcaacagcatcaataagcccttggcagaactggaagaaaat
gaggaagctgagaaagaccaagaagccataaacgctctgctcaggactccagagaaccgg
accctgatcaaacgaatgatgatcaaatgcgcggacgtgtccaacccctgccgggccctg
gagcagtgcatcgagtgggctgcgcgcatctcggaagagtacttttctcagaccgatgaa
gaaaagcagcaggacttacctgtggtgatgccggcttttgacaggaaaacctgcagcatc
cccaagtcccagatctccttcattgactacttcatcacagccatgttcgacgcctgggac
gcctttgtagacctaccagagttactgcagaacctggacaacaattttaaatactggaaa
ggactcgatgaaatgaagctgcggggcctccgaccacctctggagccagaatag

DBGET integrated database retrieval system