KEGG   Miniopterus natalensis: 107535187
Entry
107535187         CDS       T05883                                 

Gene name
STAR
Definition
(RefSeq) steroidogenic acute regulatory protein, mitochondrial
  KO
K16931  steroidogenic acute regulatory protein, mitochondrial
Organism
mna  Miniopterus natalensis
Pathway
mna04913  Ovarian steroidogenesis
mna04925  Aldosterone synthesis and secretion
mna04927  Cortisol synthesis and secretion
mna04934  Cushing syndrome
mna04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    107535187 (STAR)
   04925 Aldosterone synthesis and secretion
    107535187 (STAR)
   04927 Cortisol synthesis and secretion
    107535187 (STAR)
  09154 Digestive system
   04979 Cholesterol metabolism
    107535187 (STAR)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107535187 (STAR)
SSDB
Motif
Pfam: START Polyketide_cyc
Other DBs
NCBI-GeneID: 107535187
NCBI-ProteinID: XP_016066049
LinkDB
Position
Unknown
AA seq 285 aa
MLQAMFKLCAGSSYRHVRNMKGLRHQAMLAIGQELNRRALGGPTPSAWINQVRRRSSLLG
SRLEDTLYNDRELAYIHQGEEAMQKALGILSSQEGWKKENQQANGDKVLSKVVPDVGKVF
RLEVVVDQPMERLYEELVERMEAMGEWNPNVKEIKVLQKIGKDTVITHELAAESAGNLVG
PRDFVSVRCAKRRGSTCVLAGMATQFGEMPEQKGVIRAEHGPTCMVLHPLAGSPSKTKLT
WLLSIDLKGWLPKTIINQVLSQTQVDFANHLRKRLESSPAPEAGC
NT seq 858 nt   +upstreamnt  +downstreamnt
atgctccaagcgatgtttaaactgtgtgccgggagctcctacagacacgtgcgcaacatg
aaggggctgaggcaccaagccatgctggccattggccaggagctgaaccggagggccctg
gggggcccaaccccaagtgcatggattaaccaggtccggcggcggagctctctgcttggt
tctcggctggaagacactctctataatgaccgggagctggcctatatccaccagggagag
gaggccatgcagaaggccctgggcatcctcagcagccaggagggctggaagaaggagaac
caacaggccaatggggacaaagtgcttagtaaagtggttccagacgtcggcaaggtattc
cggctggaggtggtggtggaccagcccatggagaggctgtatgaagagcttgtggaacgc
atggaggcaatgggagagtggaacccgaatgtcaaggagataaaggtcctgcagaagatt
ggaaaagacacagtgatcacccatgagctggctgcagaatcagcaggaaacctcgtgggg
ccccgtgactttgtgagcgtgcgctgtgccaagcgccgaggctccacctgtgtgctggct
ggcatggccacacagttcggggagatgcccgagcagaaaggtgtcatcagagctgaacat
gggcccacttgcatggtgctccatcccctggctgggagtccatccaagaccaaactcact
tggctgctcagcattgacctcaagggatggctgccaaagactatcatcaaccaagtccta
tcacagacccaggtggactttgccaaccacctgcgcaagcgcctggagtccagtcctgct
cctgaagccgggtgctga

DBGET integrated database retrieval system