KEGG   Miniopterus natalensis: 107535212
Entry
107535212         CDS       T05883                                 

Definition
(RefSeq) cholesterol side-chain cleavage enzyme, mitochondrial
  KO
K00498  cholesterol monooxygenase (side-chain-cleaving) [EC:1.14.15.6]
Organism
mna  Miniopterus natalensis
Pathway
mna00140  Steroid hormone biosynthesis
mna01100  Metabolic pathways
mna04913  Ovarian steroidogenesis
mna04925  Aldosterone synthesis and secretion
mna04927  Cortisol synthesis and secretion
mna04934  Cushing syndrome
Module
mna_M00107  Steroid hormone biosynthesis, cholesterol => prognenolone => progesterone
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    107535212
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    107535212
   04925 Aldosterone synthesis and secretion
    107535212
   04927 Cortisol synthesis and secretion
    107535212
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107535212
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:mna00199]
    107535212
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.6  cholesterol monooxygenase (side-chain-cleaving)
     107535212
Cytochrome P450 [BR:mna00199]
 Cytochrome P450, animal type
  CYP11 family
   107535212
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 107535212
NCBI-ProteinID: XP_016066070
LinkDB
Position
Unknown
AA seq 520 aa
MLVRGLPLRSVLVKGCQPLLNAPQEGLGNPRVPSGEGARISTLMPRPFSEIPSPGENGWL
NLYHFWREKGSQNFHYHQVQNFQKFGPIYREKLGNMESVFIIDPEDVALLFKFEGPTPER
YCIPPWVAYHQHYQRPIGVLFKKSGAWKKDRLALNQEVMTPDAMKNFIPLLDTVSQDFVS
ILHRRIKQQGSGKFSGDISDDLFRFAFESITNVIFGERLGMLEEIVDPEAQRFIDAVYQM
FQTSVPMLMLPPGLFRLFRTKTWRDHVAAWDVIFSKAENYTQNFYLDLRQRRDFNNYPGV
LYRLLGSSKLLFEDVKANITEMLAGGVDTTSMTLQWHLYEMARSLRVQEMLREEVLAARR
QAGEDMSRMLQLVPLLKASIKETLRLHPISVTLQRYLANDLVLRDYMIPAKTLVQVAVYA
MGQDPTFFLHPGKFDPTRWLSENKDLIHFRNLGFGWGIRQCVGRRIAELEMTLFLIHILE
NFRVEIQHLNDVGTTFNLILTPDQPIFFTFRPFIQDLPEA
NT seq 1563 nt   +upstreamnt  +downstreamnt
atgctggtcagggggcttccactgcgttctgtcctggtcaaaggctgccagcccctcttg
aatgccccgcaggaggggctggggaatcccagggtgcccagtggagagggagcccgaatc
tctactctcatgcctcgccctttcagcgagatcccctcccccggtgaaaatggctggcta
aacctataccatttctggagggagaagggctcacagaatttccactatcaccaagtccag
aacttccagaagtttggccccatttacagggagaagcttggcaacatggagtccgttttt
atcattgaccctgaagatgtggcccttctctttaaatttgagggtcccaccccagaacga
tattgcatcccgccctgggttgcctatcaccagcattaccaaagacccatcggagtcctg
ttcaagaagtcaggagcctggaagaaagaccggctggccctgaaccaggaagtgatgact
ccagatgccatgaagaactttatccccctgctggacaccgtgtcccaggacttcgtcagc
atcttgcacaggcgcatcaagcagcagggctccggaaagttctcaggggacatcagtgat
gacctgtttcgctttgccttcgagtccatcaccaacgtcatatttggggagcgcttggga
atgttggaggagatcgtggaccccgaggcccagcggttcattgatgccgtttaccagatg
ttccaaaccagtgtccccatgctcatgcttcccccaggcctgtttcgtctgttcaggacc
aagacatggagggatcatgtggctgcatgggacgtgattttcagtaaagctgaaaactac
acccagaacttttacttggacctgagacagagaagagacttcaataattacccgggcgtc
ctctaccgcctcctgggaagtagcaagttgctcttcgaggatgtcaaggccaacattaca
gagatgttggctgggggtgtggacacgacgtccatgacactgcagtggcacttgtacgag
atggcacgcagcctgagagtgcaggagatgctgcgggaggaggtcctggctgctcggcgc
caggccggggaagacatgagcaggatgctgcagttggtcccgcttctaaaagctagcatc
aaggagacactgagactccaccccatctccgtgaccctgcagagataccttgcaaatgac
ttggttcttcgagattacatgattcctgccaagacattggtgcaggtggccgtctatgcc
atgggacaagatccaaccttcttcctccatccgggcaaatttgaccccacccgatggctg
agtgaaaacaaggacctcatccacttccggaatctaggctttggctgggggattcggcag
tgcgtgggccggcggatcgccgagctcgagatgaccctcttccttatccatattctggag
aatttcagagttgaaatccaacatctcaatgatgtgggcacaacgttcaacctcatcctg
acacccgaccagcccatcttcttcaccttccggccttttatccaggacctgcctgaggca
tga

DBGET integrated database retrieval system