KEGG   Miniopterus natalensis: 107535216
Entry
107535216         CDS       T05883                                 

Definition
(RefSeq) cytochrome P450 1A1
  KO
K07408  cytochrome P450 family 1 subfamily A1 [EC:1.14.14.1]
Organism
mna  Miniopterus natalensis
Pathway
mna00140  Steroid hormone biosynthesis
mna00380  Tryptophan metabolism
mna00830  Retinol metabolism
mna00980  Metabolism of xenobiotics by cytochrome P450
mna01100  Metabolic pathways
mna04913  Ovarian steroidogenesis
mna05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    107535216
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    107535216
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    107535216
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    107535216
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    107535216
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    107535216
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:mna00199]
    107535216
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     107535216
Cytochrome P450 [BR:mna00199]
 Cytochrome P450, animal type
  CYP1 family
   107535216
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 107535216
NCBI-ProteinID: XP_016066072
LinkDB
Position
Unknown
AA seq 516 aa
MFSVFGLSISVSATELLLVSTIFCLVFWVLRAWQPRVPKGLKSPPGPWGWPLIGHMLTLR
KSPHLALSRLSQRYGDVLEIRIGCTPVLVLSGLDTVRRALVQQGDDFKGRPDLYSFTLIS
DGQSMTFNPDSGPMWAARRRLAQNALKSFSITSDPASSSSCYLEEHVSKEAEVLISKFQE
LMAGVGHFDPYRYVVVSVANVICAMCFGQRYDHDDQELLSIVNLNNEFGEMAASGNLTDF
FPILRYLPNPALSIFKDLNKKFYTFMQKKVKEHYKMFEKGHIRDITDSLIEHCQDKKLDE
NANIQLSDEKIVNVVMDLFGAGFDTVTTAISWSLLYLVTSPSVQKKIQEELDTVIGRARR
PRLSDRSQLPYMEAFILETFRHSSFVPFTVPHSTTRDTNLSGFYIPKGRCVFVNQWQINH
DQKLWDDPSEFRPERFLTPNGTINKALSEQVILFGLGKRKCIGETIARFEVFLFLAILLQ
QVEFSMLPGVKVDMTPIYGLTMKYARCEHFQVQVRF
NT seq 1551 nt   +upstreamnt  +downstreamnt
atgttttctgtgtttggactctccatctccgtctcggccacggaacttctcctggtctcc
acaatcttctgcctggtattctgggtgttaagggcctggcagcctcgggtccccaaaggc
ctgaagagtccaccagggccctggggttggcctctgattggacacatgctgaccttgagg
aagagcccacacctggccctgtcgcggctgagccagcgctatggggacgtgctagagatc
cgaattggctgcacacctgtgctggtgctcagtggcctggacaccgtccggcgggctctg
gtgcagcagggcgatgatttcaagggcaggcccgacctctacagcttcaccctgatctct
gatggccagagcatgaccttcaacccagactctggacctatgtgggctgcccgccggcgc
ctagcccagaatgccctgaagagtttttccatcacctcagacccagcttcctcatcttcc
tgttacttggaggagcatgtgagcaaggaggctgaggtcctcatcagcaagttccaggag
ctgatggcaggggttggacactttgacccctacaggtatgtagtggtatcagtggccaac
gtcatctgtgccatgtgctttggtcagcgctatgatcatgatgaccaagagctacttagt
atagtcaacctgaataatgagttcggagagatggctgcttctggaaatctgactgacttc
ttccctatcctccgttacctacccaaccctgccctgagtatcttcaaggacctgaataag
aagttctacaccttcatgcaaaagaaggttaaggaacactataaaatgtttgagaagggc
cacatccgggacatcacagacagcctgatcgagcactgtcaggacaagaagctggatgag
aacgccaatatccagttgtcagacgagaagattgttaatgtcgtcatggacctctttgga
gctggatttgacacagtcacaacagccatctcttggagcctcttgtacctggtgacgagc
cccagtgtgcagaaaaaaatccaggaggagcttgacacagtgattgggagggcacggcgg
ccccggctctctgacagatcccagctgccctatatggaggccttcatcctggagaccttc
cgacactcctcctttgtccccttcactgtcccccacagtaccaccagagacacaaatctg
agtggcttttacattcccaaggggcgttgtgtctttgtgaaccagtggcagatcaaccac
gaccagaaactgtgggatgacccatctgagttccggccagaacggtttctcacccccaat
ggcactatcaacaaggcactgagtgagcaggtgattctttttggcctaggcaagcggaag
tgcatcggtgagaccattgcccgctttgaggtctttctcttcctggccatcctgctgcag
caggtagaattcagcatgctaccaggtgtgaaggtggacatgacccccatctatgggctg
accatgaagtatgcccgctgtgagcacttccaggtacaggttcgcttttag

DBGET integrated database retrieval system