KEGG   Miniopterus natalensis: 107535226
Entry
107535226         CDS       T05883                                 

Gene name
CD74
Definition
(RefSeq) HLA class II histocompatibility antigen gamma chain
  KO
K06505  CD74 antigen
Organism
mna  Miniopterus natalensis
Pathway
mna04612  Antigen processing and presentation
mna05152  Tuberculosis
mna05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    107535226 (CD74)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107535226 (CD74)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107535226 (CD74)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mna04090]
    107535226 (CD74)
   00535 Proteoglycans [BR:mna00535]
    107535226 (CD74)
CD molecules [BR:mna04090]
 Proteins
  107535226 (CD74)
Proteoglycans [BR:mna00535]
 Cell surface proteoglycans
  Others
   107535226 (CD74)
SSDB
Motif
Pfam: MHC2-interact MHCassoc_trimer
Other DBs
NCBI-GeneID: 107535226
NCBI-ProteinID: XP_016066082
LinkDB
Position
Unknown
AA seq 216 aa
MEDQRDLISNHEQLPMLGQRPAAQESKCSRGALYTGFSVLVALLLAGQATTAYFLYQQQG
RLDKLTVTSQNLQLESLRMKLPKPAKTLSKMRIATPMLMQALPMEGLMQGPMQNATKYGN
STLDHVMHQLLRADPLKVYPQLKGSFPENLKYLKKTMDGLDWKVFESWMHQWLLFEMSKN
SPEEKLTEGSPKEPLDMEDLSSGLGVTKQDLVQAIM
NT seq 651 nt   +upstreamnt  +downstreamnt
atggaagaccagcgcgacctcatctccaaccacgagcagctgcccatgctgggccagcgc
cccgcggcccaggagagcaagtgcagccgtggagccctgtacacaggcttttctgtcctg
gtggctctgctcctggctggtcaagccaccaccgcctacttcctgtaccagcagcagggc
cggctggacaagctgacggtcacctcgcagaacctgcagctggagagcctgcgcatgaag
cttcccaagcctgccaagactttgagcaagatgcggatagccacccccatgctgatgcag
gcgctgcccatggaaggcctgatgcaggggcccatgcagaacgccaccaagtacggcaac
agcacactggaccatgtgatgcaccagctcctgagggctgatcccctgaaggtgtaccca
cagctgaaggggagcttcccagagaacctgaaataccttaagaagaccatggatggcctg
gactggaaggtctttgagagctggatgcatcagtggcttttgtttgaaatgagcaagaac
tcaccggaggagaagctcactgaaggttcaccaaaagagccactggacatggaggatctg
tcgtccgggctgggcgtgaccaagcaggatctggtccaagccatcatgtga

DBGET integrated database retrieval system