KEGG   Miniopterus natalensis: 107535326
Entry
107535326         CDS       T05883                                 

Gene name
IFI30
Definition
(RefSeq) gamma-interferon-inducible lysosomal thiol reductase
  KO
K08059  interferon, gamma-inducible protein 30
Organism
mna  Miniopterus natalensis
Pathway
mna04612  Antigen processing and presentation
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    107535326 (IFI30)
SSDB
Motif
Pfam: GILT
Other DBs
NCBI-GeneID: 107535326
NCBI-ProteinID: XP_016066221
LinkDB
Position
Unknown
AA seq 243 aa
MAWSLLLLFLPVLLLQVPAAARASPLDTLPEGAAPCKAGNLCPHVPLGKPRAPPVNVSLY
YEALCPGCRSFLVRELFPTWLMVLEILNVTLVPYGNAKEQNVSGKWEFTCQHGEEECKLN
KVEACLLDQLTWNAAFLSIVCLEEMDDMENSLKPCLQLYAPKVSPDTIMECAMGDRGTQL
LHMNAQLTDALQPPHEYVPWVVVNGKPLEDMSQLLTVVCQLYQGEKPDVCPFMASSHRDV
CLK
NT seq 732 nt   +upstreamnt  +downstreamnt
atggcctggtcgctactcctgctgttcctgcccgtgctgctgctccaggtccccgcggcg
gcgcgcgcgtccccgctggacacactccccgagggcgcggccccctgtaaggctggtaac
ctgtgcccacacgtgccccttgggaagccccgcgcaccacctgtcaacgtgagcctctat
tatgaggcactgtgccctggctgccggtccttcctcgtccgagagctgttcccaacatgg
ctgatggtcctggagatcctcaatgtcactctggtgccctatggaaatgccaaggaacag
aatgtcagcggcaagtgggagttcacgtgccagcatggggaggaggagtgcaagttaaac
aaggtggaggcctgcctgttggaccagctgacgtggaacgcagccttcctatccattgtc
tgcttagaggaaatggatgacatggagaacagtctgaagccgtgcctgcagctctatgcc
ccaaaggtgtccccagacaccatcatggagtgcgcaatgggggaccgcggcacacagctc
ttgcacatgaatgcccaacttacagacgctctgcagccaccccacgagtatgtgccttgg
gtcgtcgtcaatgggaaacctttggaagacatgagccagctcctaaccgtcgtgtgccag
ttgtaccagggtgagaagccagatgtctgcccattcatggccagctcccacagggatgtc
tgcctcaagtga

DBGET integrated database retrieval system