KEGG   Miniopterus natalensis: 107535368
Entry
107535368         CDS       T05883                                 

Gene name
SLC5A5
Definition
(RefSeq) sodium/iodide cotransporter
  KO
K14385  solute carrier family 5 (sodium/iodide cotransporter), member 5
Organism
mna  Miniopterus natalensis
Pathway
mna04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    107535368 (SLC5A5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107535368 (SLC5A5)
Transporters [BR:mna02000]
 Solute carrier family (SLC)
  SLC5: Sodium glucose cotransporter
   107535368 (SLC5A5)
SSDB
Motif
Pfam: SSF
Other DBs
NCBI-GeneID: 107535368
NCBI-ProteinID: XP_016066291
LinkDB
Position
Unknown
AA seq 640 aa
RATFGAWDYGVFALMLLVSTGIGLWVGLARGGQRSAEDFFTGGRRLTALPVGLSLAASFM
SAVQVLGVPAEAYRYGLKFLWMCLGQLLNSLLTAAFYLPVFYRLGLTSTYQYLELRFSRA
VRLCGTLQYLVATVLYTGIVIYAPALILNQVSGLDIWASLLSTGAICTFYTTVGGMKAVI
WTDMFQVVVMLAGFWVVLVRGTMLVGGPRQVFKLAQNQSRINLMDFDPDPRSRYTFWTLV
VGGTLVWLSMYGVNQAQVQRYVACRTEKQAKLALLVNQLGLFLIVSSAAGCGIVMFTLYM
DCDPLLTGRISAPDQYMPLLVLDIFKDLPGIPGLFLACAYSGTLSTASTSINAMAAVTVE
DLIKPRLPSLAPRRLVIISKGLSLIYGLACITVAALSSLLESGVLQGSFTVMGVLSGPLL
GAFTLGIFLPACNTPGVLSGLLAGFLLSLWVAVGATLYPPSAKSMGALPSSAAACAGPSA
NASGLLGPLLLANASSGAPGMDPGRPTLADSFYAISYLYYGALGTLSTMLCGALISYLTG
PTKRSALGPGLLWWDLTLQTALVAPKEEVATQDDSLVKGAEELSPRAKRPPDFLPTNEDQ
LLFLGQKEVKGASSGSWNPRSGREGGRGLRETDLSEPAQD
NT seq 1923 nt   +upstreamnt  +downstreamnt
cgggccacgttcggagcctgggactatggggtcttcgcgctcatgctcctcgtgtccacg
ggcatcgggctgtgggtggggctggcgcggggcgggcagcgcagcgctgaggatttcttc
accgggggtcggcgcctcacggccctgccggttggcctctcgctggccgccagcttcatg
tcggccgtgcaggtgctgggtgtaccggccgaggcctatcgctacggcctcaagtttctc
tggatgtgcctgggccagctgctcaactccctactgaccgctgccttctacctgccagtc
ttctaccgcctgggcctcaccagcacttaccagtacctggagctgcgtttcagccgcgct
gtgcggctctgtgggaccctgcagtacctggtggccacagtgctatacacgggcatcgtg
atctacgccccagcgctcattctcaaccaagtgtctgggctggacatatgggcatcactc
ctgtccactggagccatctgtaccttctacaccactgtgggcggcatgaaggctgtgatt
tggactgacatgttccaggttgtggtgatgctggctggtttctgggttgtcctggttcgt
gggaccatgcttgtgggcgggcccaggcaggtgttcaaactggcccagaaccagtcccgg
atcaacctgatggactttgacccagacccacggagtcgctacacattctggactttggtg
gtgggaggcacgttggtgtggctctcaatgtatggagtgaaccaagcacaggtgcagcgc
tatgtggcctgtcgcacagagaagcaggccaagctggccctgctcgtcaaccagctgggc
ctgttcctgattgtgtccagtgctgctggctgcggcatcgtcatgttcacgctctatatg
gactgtgaccccctcctcacagggcgtatttctgcccctgaccagtacatgcccctacta
gtgctggacatcttcaaggacctgcctggaatccctgggctctttctggcctgtgcctac
agtggtaccctcagcaccgcatccactagcatcaacgccatggctgcggtcaccgtggag
gacctcatcaaaccacggctgcccagcctggcgccccggagactcgtaatcatctccaag
gggctctcactcatatatggcttggcctgtatcacggtggcagctctgtcttccctgctg
gaaagcggcgtcctccagggctccttcactgtcatgggcgtcctcagcgggcccctcctc
ggagccttcactctgggaatattcctccccgcctgcaacacacccggcgtgctctccggg
ctgctggccggcttcctgctctcgctgtgggtggccgtgggcgccactctgtacccgccc
agcgcgaagtccatgggggccctgccgtcctctgctgccgcctgcgcggggccctcggcc
aacgcctctggcctcctagggcccctcctgctcgccaacgcctccagtggggctcccgga
atggaccctggccgacccaccttggctgacagcttctacgccatttcctatctttattat
ggtgccctgggcacactgagcaccatgctgtgcggagccctcatcagctacctgacaggc
ccaaccaagcgcagtgccctgggtcctggtctgctgtggtgggacctcacattgcagaca
gcattggtggctcccaaggaagaagtggccactcaggatgacagcttggtgaagggggct
gaggaactgtctcccagggctaagaggcctcctgacttcctgcccaccaacgaggaccag
ctgctcttcctggggcagaaggaggtgaagggagccagctctggctcctggaaccctcgc
agtgggcgcgagggtggccgcggcctgcgggagacagacctctctgagcccgcccaggac
tga

DBGET integrated database retrieval system