KEGG   Miniopterus natalensis: 107535458
Entry
107535458         CDS       T05883                                 

Gene name
SLC31A1
Definition
(RefSeq) high affinity copper uptake protein 1
  KO
K14686  solute carrier family 31 (copper transporter), member 1
Organism
mna  Miniopterus natalensis
Pathway
mna01524  Platinum drug resistance
mna04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    107535458 (SLC31A1)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107535458 (SLC31A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107535458 (SLC31A1)
Transporters [BR:mna02000]
 Solute carrier family (SLC)
  SLC31: Copper transporter
   107535458 (SLC31A1)
SSDB
Motif
Pfam: Ctr
Other DBs
NCBI-GeneID: 107535458
NCBI-ProteinID: XP_016066409
LinkDB
Position
Unknown
AA seq 190 aa
MSHSHHMGMNPVDHNSTMPPPHHHAATSASHLHGGADSSMMMMQMTFYFGFKNVELLFSG
LVINTAGEMAGAFVGVFLLAMFYEGLKIARESLLRKSQVSIRYNSMPVPGPNGTILMETH
KTVGQQMLSFPHLLQTVLHIIQVVISYFLMLIFMTYNGYLCIAVAAGAGTGYFLFSWKKA
VVVDITEHCH
NT seq 573 nt   +upstreamnt  +downstreamnt
atgagccattcccaccatatggggatgaaccctgtggaccacaacagtaccatgccgccg
cctcaccatcacgcggccacttcggcctcccacctgcacgggggggcggacagcagcatg
atgatgatgcaaatgaccttctactttggctttaagaatgtggaattattgttttctggc
ttggtgatcaatacagctggagaaatggctggagcttttgtgggagtgtttttactagca
atgttctatgaagggctcaagatagcccgagagagcctgctgcgcaagtcacaagtcagc
attcgctacaattccatgcccgtcccaggaccaaatggaaccatccttatggagacacac
aaaactgttgggcaacagatgctgagctttcctcacctcctgcagacagtgctgcatatc
atccaggtggtcatcagctacttcctcatgctcatcttcatgacctacaatgggtacctg
tgcatcgctgtggcagcgggggccggcacagggtacttcctcttcagctggaagaaggca
gtggtagtggacatcacagagcattgccattaa

DBGET integrated database retrieval system