KEGG   Miniopterus natalensis: 107535479
Entry
107535479         CDS       T05883                                 

Definition
(RefSeq) steroidogenic factor 1
  KO
K08560  steroidogenic factor 1
Organism
mna  Miniopterus natalensis
Pathway
mna04927  Cortisol synthesis and secretion
mna04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    107535479
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107535479
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107535479
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mna03310]
    107535479
Transcription factors [BR:mna03000]
 Eukaryotic type
  Zinc finger
   Cys4 Fushi tarazu-F1-like
    107535479
Nuclear receptors [BR:mna03310]
 5. Fushi tarazu-F1 like
  5A. Fushi tarazu-F1 like receptor
   107535479
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 107535479
NCBI-ProteinID: XP_016066444
LinkDB
Position
Unknown
AA seq 473 aa
METWEVSVPDDRAEQRTCLICGDRATGLHYGIISCEGCKGFFKRSICNKRRTVQNNKHYT
CTESQSCKIDKTQRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQ
KKAQIRANGFKMETGPPVGVPPLPPPPPDYMLPPGLHGPEPKGLGSGPPAGPLGDFGAPA
LPMAVPGAHGPLAGYLYPTFPGRAIKSEYPEPYASPPQPGPPYGYPEPFSGGPGVPELIL
QLLQLEPDEDQVRARILGCLQEPTKGRSDQPAPFSLLCRMADQTFISIVDWARRCMVFKE
LEVADQMTLLQNCWSELLVFDHIYRQIQHGKEDSILLVIGQEVELSTVAAQAGSLLHSLV
LRAQELVLQLHALQLDRQEFVCLKFLILFSLDVKFLNNHSLVKDAQEKANAALLDYTLCH
YPHCGDKFQQLLLCLVEVRALSMQAKEYLYHKHLGNEMPRNNLLIEMLQAKQT
NT seq 1422 nt   +upstreamnt  +downstreamnt
atggagacatgggaagtttctgttccagatgatcgggctgaacaacgaacctgtctcatt
tgtggagaccgcgccacaggcttgcactatggaatcatctcctgtgagggctgcaaaggg
tttttcaagcggagcatttgcaacaagcggcgcacggtgcagaacaacaagcactacacg
tgcaccgagagccagagctgcaagatcgacaagacgcagcgcaagcgctgtcccttctgc
cgcttccagaagtgcctgacggtggggatgcgcctggaagctgtacgtgctgaccgcatg
cggggcggccggaacaaatttgggcccatgtacaagagggaccgggccctgaagcagcag
aagaaggcacagattcgagccaatggcttcaagatggagacaggccccccagtgggggta
cccccactgcctcctcccccaccggactacatgctaccccctggcctgcacggcccagag
cccaagggcctgggctctggtccccctgctgggcccctgggcgactttggggccccagca
ctgcccatggccgtgcctggtgcccacgggcccctggctggctacctctatcccaccttc
cctggccgtgccatcaagtcagagtacccagagccctacgccagcccaccgcagcccggg
ccgccctatggctacccagagcccttctctggagggcctggcgtgcccgagctcatcctg
cagctgctgcagctggagccagatgaggaccaggtgcgggcgcgcatcctgggctgcctg
caggaaccaaccaaaggccgctccgaccagcctgcgcccttcagcctcctgtgcaggatg
gctgaccagaccttcatctccatcgtcgactgggcacgcaggtgcatggtcttcaaggag
ctggaggtggccgaccagatgacgctgctgcagaactgctggagcgagctgctggtgttt
gaccacatctaccgccagatccaacatggcaaggaggacagcatcctgctggtcatcggg
caggaggtggagctgagcacggtggccgcccaggccggctccctgctgcacagcctggtg
ctgcgggcgcaggagctcgtcctgcagctgcacgcgctgcagctggaccgccaggagttc
gtctgcctcaagttcctcatcctcttcagcctcgatgtgaagttcctgaacaaccacagc
ctggtgaaggatgctcaggagaaggccaacgccgccctgctcgattacaccctgtgccac
tacccgcactgcggggacaagttccagcagctgctgctgtgcttggtggaggtgcgggcg
ctgagcatgcaggccaaggagtacctgtaccacaagcacctgggcaacgagatgccccgc
aacaacctgctcatcgagatgctgcaagccaagcagacttga

DBGET integrated database retrieval system