KEGG   Miniopterus natalensis: 107535485
Entry
107535485         CDS       T05883                                 

Symbol
HSPA5
Name
(RefSeq) 78 kDa glucose-regulated protein
  KO
K09490  endoplasmic reticulum chaperone BiP [EC:3.6.4.10]
Organism
mna  Miniopterus natalensis
Pathway
mna03060  Protein export
mna04141  Protein processing in endoplasmic reticulum
mna04612  Antigen processing and presentation
mna04918  Thyroid hormone synthesis
mna05012  Parkinson disease
mna05014  Amyotrophic lateral sclerosis
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    107535485 (HSPA5)
   04141 Protein processing in endoplasmic reticulum
    107535485 (HSPA5)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    107535485 (HSPA5)
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    107535485 (HSPA5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107535485 (HSPA5)
   05014 Amyotrophic lateral sclerosis
    107535485 (HSPA5)
   05020 Prion disease
    107535485 (HSPA5)
   05022 Pathways of neurodegeneration - multiple diseases
    107535485 (HSPA5)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    107535485 (HSPA5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mna03110]
    107535485 (HSPA5)
   04131 Membrane trafficking [BR:mna04131]
    107535485 (HSPA5)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107535485 (HSPA5)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.10  non-chaperonin molecular chaperone ATPase
     107535485 (HSPA5)
Chaperones and folding catalysts [BR:mna03110]
 Heat shock proteins
  HSP70 / DNAK
   107535485 (HSPA5)
Membrane trafficking [BR:mna04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    107535485 (HSPA5)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107535485 (HSPA5)
  Exosomal proteins of other body fluids (saliva and urine)
   107535485 (HSPA5)
  Exosomal proteins of colorectal cancer cells
   107535485 (HSPA5)
SSDB
Motif
Pfam: HSP70 MreB_Mbl FtsA Hydantoinase_A FGGY_C DDR DUF4795 RNB
Other DBs
NCBI-GeneID: 107535485
NCBI-ProteinID: XP_016066451
LinkDB
Position
Unknown
AA seq 654 aa
MKLSLVAAVLLLLGAALAEEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNR
ITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWSDPSVQQDIKFLPFKVV
EKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQ
RQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNG
VFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALS
SQHQARIEIESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIV
LVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVC
PLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLG
TFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIER
MVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEE
KIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSAGPPPTGDEEPVDKDEL
NT seq 1965 nt   +upstreamnt  +downstreamnt
atgaagctctccctggtggctgcggtgctgctgctgctcggcgcagcgctggccgaggag
gaagacaagaaagaggacgtgggcacggtggtcggcatcgacctgggcaccacctactcc
tgcgtcggggtgtttaagaacggccgcgtggagatcatcgccaacgatcagggcaaccgc
atcacgccgtcttatgtggccttcactcctgaaggggagcgtctgatcggagacgcagcc
aagaatcagctcacctccaaccccgagaacacggtcttcgacgccaagcggcttatcggc
cgcacatggagcgacccgtctgtgcagcaggacatcaagttcttgcctttcaaggtggtt
gaaaagaaaactaaaccatacattcaagttgatattggaggtgggcaaacaaagactttt
gctcctgaagaaatatctgccatggttctcactaaaatgaaggaaactgctgaggcttac
ttgggaaaaaaggttacccatgcagttgttactgtaccagcctacttcaatgatgcccaa
cgccaggcaaccaaagatgctggaactatcgctggattgaatgtcatgagaatcatcaat
gagcctacagcagctgctattgcttatggcctggataagagggaaggggagaagaacatc
ctggtgtttgacctgggtggtggaacctttgatgtgtctcttctcaccattgataatggt
gtctttgaagttgtggccactaatggagatactcatctgggtggagaagactttgatcag
cgtgtcatggaacacttcatcaagctctacaaaaagaagactggcaaagatgttaggaaa
gacaacagagctgtgcagaaactccggcgtgaggtagaaaaggccaaacgggccctgtct
tctcaacatcaagcaagaattgaaattgagtccttctatgaaggagaagacttctctgag
accctgactcgggccaaatttgaagagctaaacatggacctgttccgttctaccatgaag
cctgtccagaaagtgctggaagattctgatttgaagaagtctgatattgatgaaattgtt
cttgttggtggctctactcgaatcccaaagattcaacaactggttaaagagttcttcaat
ggcaaggagccatcccgtggcataaacccagatgaggctgtagcgtatggtgctgctgtc
caggctggtgtactctctggtgatcaagatacaggtgatctggtactgcttgatgtatgt
ccccttacgcttggtattgaaaccgtgggaggtgtcatgaccaaactgattccaaggaac
actgtggtgcccaccaagaagtcacaaatcttttctacagcctctgataatcagccaact
gttacaatcaaggtttatgaaggtgaacgccccctgacaaaagacaatcatctcctggga
acttttgatctgactggaattcctcctgctccccgtggggtcccacagattgaagtcacc
tttgagatagatgtgaatggcattctccgagtgacagctgaagacaaaggtacaggcaac
aaaaataagatcacaattaccaatgaccaaaatcgcctgacacctgaagaaattgaaagg
atggttaatgatgcagagaagtttgctgaggaagacaaaaagctcaaagagcgcattgat
accagaaatgaattggaaagctatgcctattctctaaagaatcagattggtgataaagaa
aagctgggaggtaaactttcctctgaagataaggagaccatggaaaaagccgtagaggaa
aagattgaatggctggaaagtcaccaagatgctgacatcgaagatttcaaagctaagaag
aaggaactagaagaaattgttcagccaattatcagcaaactctatggaagtgcaggtcct
cccccaactggtgatgaggaaccagtagacaaagatgagttgtag

DBGET integrated database retrieval system