KEGG   Miniopterus natalensis: 107535558Help
Entry
107535558         CDS       T05883                                 

Gene name
SHC4
Definition
(RefSeq) LOW QUALITY PROTEIN: SHC-transforming protein 4
  KO
K17449  SHC-transforming protein 4
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna01522  Endocrine resistance
mna04012  ErbB signaling pathway
mna04014  Ras signaling pathway
mna04062  Chemokine signaling pathway
mna04072  Phospholipase D signaling pathway
mna04510  Focal adhesion
mna04650  Natural killer cell mediated cytotoxicity
mna04722  Neurotrophin signaling pathway
mna04910  Insulin signaling pathway
mna04915  Estrogen signaling pathway
mna04917  Prolactin signaling pathway
mna04926  Relaxin signaling pathway
mna04935  Growth hormone synthesis, secretion and action
mna05034  Alcoholism
mna05100  Bacterial invasion of epithelial cells
mna05206  MicroRNAs in cancer
mna05214  Glioma
mna05220  Chronic myeloid leukemia
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107535558 (SHC4)
   04012 ErbB signaling pathway
    107535558 (SHC4)
   04072 Phospholipase D signaling pathway
    107535558 (SHC4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107535558 (SHC4)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107535558 (SHC4)
   04062 Chemokine signaling pathway
    107535558 (SHC4)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107535558 (SHC4)
   04915 Estrogen signaling pathway
    107535558 (SHC4)
   04917 Prolactin signaling pathway
    107535558 (SHC4)
   04926 Relaxin signaling pathway
    107535558 (SHC4)
   04935 Growth hormone synthesis, secretion and action
    107535558 (SHC4)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107535558 (SHC4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    107535558 (SHC4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107535558 (SHC4)
   05226 Gastric cancer
    107535558 (SHC4)
   05214 Glioma
    107535558 (SHC4)
   05220 Chronic myeloid leukemia
    107535558 (SHC4)
   05224 Breast cancer
    107535558 (SHC4)
  09165 Substance dependence
   05034 Alcoholism
    107535558 (SHC4)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    107535558 (SHC4)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107535558 (SHC4)
   01522 Endocrine resistance
    107535558 (SHC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PID SH2 Delta_lysin
Motif
Other DBs
NCBI-GeneID: 107535558
NCBI-ProteinID: XP_016066553
LinkDB All DBs
Position
Unknown
AA seq 630 aa AA seqDB search
MRERGRDGXGGLALRLGLFGRPGMLHRAKYSRFRNESITSLDEGSPGGAAGSKGSPQPPC
PALAPHLPAEDAAAPAQEGPTPLCALIPRMASVKLANPAALLSLKNFCLGTKEVPRLKLQ
ESQDPAPSSPASPENSLHRPGSAPQPRRDAAGPRATGSAPEACPLPGPGGPTPRRGQDRH
FLQHLLGTGMNYYVKYMGCIEVLQSMRSLDFGMRTQVTREAISRLCEAVPGANGAIKKRK
PPVKFLSTVLGKSNLQFSGMNIKLTISTCSLTLMNLDNQQIIANHHMQSISFASGGDPDT
TDYVAYVAKDPVNQRACHILECRNGMAQDVISTIGQAFELRFKQYLKNPSLSTSCESEEV
HVDGHAEDREDHEYYNEIPGKQPPVGGVSDVRVRVQVTEQMAYCPIRCEKLCYLPGNSKC
SSVYENCLEQSRAIGNAHERAVQSQSDASLLKPTCRVDLFDDPCYINTQALHSALGPARN
QSPAQPPGSPWHREKAPETVQPGATAQTASSHSLPHIQQQLRHEDCYHGKLSRKAAESLL
VKDGDFLVRESATSPGQYVLSGLQGGQAKHLLLVDPEGKVRTKDHIFDNVGHLIRYHMDN
SLPIISSGSEVSLKQPVRRDNIPGLLHLNK
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgcgagagcgcggccgggacggcnccggggggctcgcgctgcgcctaggactcttcggc
cgccccgggatgctgcacagggccaagtacagccgctttcggaacgagtccatcacgtcc
ttggacgaaggcagtcccggcggcgccgcgggcagcaagggctcgccgcagcctccctgc
ccggccctggccccgcacctgccggcggaggatgcggccgcgccggcccaggagggcccc
accccgctgtgcgccttgatcccgcgcatggccagcgtgaagctcgccaacccagccgcc
ctgctgagtctgaaaaacttttgcttgggtaccaaagaggtaccccggctgaagcttcag
gaaagccaggacccggctcccagcagcccggcttcccccgaaaacagcctgcatagaccc
gggtctgcaccccagccccggcgggacgcggcggggccccgggcgaccggctcggctccc
gaggcctgtcccctccccggccctggggggcccaccccgaggcgcgggcaggacaggcac
tttctgcagcacctgctggggacgggcatgaactactatgtgaagtacatgggctgtatt
gaagtgctgcaatcaatgaggtcactggattttggaatgagaactcaagttacaagggaa
gcaataagtcgtctgtgtgaagctgtccctggggcaaacggagccattaaaaaacggaag
cctccagttaagttcctatcaacagttcttggcaaaagtaatcttcagttttctggaatg
aacataaaactgaccatctcaacatgcagcctcacactgatgaatcttgacaaccaacag
attattgcaaatcatcacatgcagtctatttcatttgcctctggaggggatcctgatact
acagactatgttgcctacgtagctaaagatccagttaatcaacgagcctgccacatattg
gaatgccgcaacgggatggcccaagatgtcataagtaccatagggcaggcttttgagctc
cggtttaaacaatatttgaaaaatccttctttgagtacttcttgtgaaagtgaggaggtg
catgttgatggccatgctgaggacagagaagatcatgagtattacaatgagataccagga
aagcagccacctgtgggtggtgtttcagatgtgcgggtcagagttcaagtcacagaacaa
atggcttactgccccatacgctgtgaaaagttgtgctatttgcctggaaactccaagtgc
agcagtgtctatgagaactgtttggagcaaagcagggcaatcggtaacgcccacgagaga
gccgtgcagtcccagagcgacgcctccttattgaagcccacctgccgggtggacctgttc
gacgatccctgctacatcaacacgcaggctcttcacagtgcactcggccctgcccgaaac
caaagcccagctcagccgccggggagcccgtggcaccgtgagaaagcaccagaaaccgtc
cagccaggtgccaccgcccagactgccagctcacattctttgccacacattcagcagcag
ctgcggcatgaagactgctaccatggcaagctgagcaggaaggcggcagagagcctctta
gtgaaggatggcgactttttggttcgcgagagtgcaacatctcctggccagtatgtgctg
agtgggctccagggaggccaggccaaacatcttctcctggtggatcctgaaggcaaggtg
aggaccaaggaccacatatttgataacgtcggccaccttatcaggtaccacatggataac
agtttgccaatcatctcttctggaagcgaagtcagccttaaacaaccggtgagaagagat
aatattccaggacttttgcatttaaacaaatga

DBGET integrated database retrieval system