KEGG   Miniopterus natalensis: 107535587Help
Entry
107535587         CDS       T05883                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin G/H synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
mna  Miniopterus natalensis
Pathway
mna00590  Arachidonic acid metabolism
mna01100  Metabolic pathways
mna04611  Platelet activation
mna04726  Serotonergic synapse
mna04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107535587 (PTGS1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107535587 (PTGS1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    107535587 (PTGS1)
  09156 Nervous system
   04726 Serotonergic synapse
    107535587 (PTGS1)
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     107535587 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 107535587
NCBI-ProteinID: XP_016066577
LinkDB All DBs
Position
Unknown
AA seq 555 aa AA seqDB search
MCVRFGLDRYQCDCTRTGYSGPNCTDPELWTWLRNSLRPSPSFIHFLLTHGRWFWELINA
TFIRDMLMRLVLTARSNLIPSPPTYNLAHDYISWESFSNLSYYTRVLPSVPQDCPTPMGT
KGKKQLPDAELLSRHFLLRRKFIPDPQGANLMFAFFAQHFTHQFFKTSGKMGPGFTKALG
HGVDLGHIYGDNLDRQYQLRLFKDGKLKYQMLDGEMYPPSVEEAPVLMHYPRGIPPRSQM
AMGQEVFGLLPGLMLYATLWLREHNRVCDLLKAEHPTWEDEQLFQTARLILIGETIKIVI
EEYVQQLSGYFLQLKFNPELLFGSQFQYQNRIAMEFNVLYHWHPLMPDSFKVGSQDYSYE
QFLFNTSMLVDNGVEALVDAFSRQNAGRIGGGRNIDHHILHVATEVIKESRELRLQPFNE
YRKRFGMKPYTSFQEFTGEKEMAAELEELYGDIDALEFYPGLLLEKCHPSSIFGESMIEI
GAPFSLKGLLGNAICSPEYWKASTFGGEMGFNIVKTATLKKLVCLNTKTCPYVSFHVPDP
HHNDGAGVERPSTEL
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgtccgctttggcctcgaccgctaccagtgtgactgcacccgcaccggctactcg
ggccccaactgcaccgaccctgagctgtggacctggctccggaattcactgcggcccagc
ccctctttcatccacttcctgctgacgcacgggcgctggttctgggagcttatcaatgcc
accttcatccgtgacatgctcatgcgcctggtactcacagcgcgttccaaccttatcccc
agcccccccacctacaacttagcacacgattacatcagctgggagtccttctccaacctg
agctactacactcgtgttctgccctctgtgccgcaagactgccccacacccatggggacc
aaagggaagaagcagctgccagatgccgagctcctgagccgtcacttcctgctcaggagg
aagttcatacctgacccccaaggtgccaacctcatgtttgccttttttgcacaacacttc
acccaccagttcttcaaaacttctggcaagatgggtcctggcttcaccaaggccttgggc
catggggtagacctcggccacatttatggggataatctggaccgtcaatatcagctgcga
ctctttaaggatgggaaactcaagtaccagatgctggacggagagatgtacccaccgtcg
gtggaagaggcgcctgtgctgatgcactacccacggggcattccgccccggagccagatg
gccatgggccaggaggtgtttggactgcttcccgggctcatgctttacgccacgctctgg
ctgcgtgaacacaaccgcgtgtgtgacctgctgaaggctgagcaccccacctgggaagat
gagcagctcttccagacagcccgcctcatccttataggggagaccatcaagatcgtgatc
gaggagtatgtgcagcagctgagcggctacttcctgcagctcaagttcaacccagagctg
ctgttcggctcccagttccagtaccagaaccgcattgccatggagttcaacgtgctctac
cactggcacccgctcatgcccgactccttcaaggtgggttcccaggactacagctatgag
cagttcctgttcaacacctccatgctggtggacaatggagtcgaggccctggtggatgcc
ttctctcgccagaacgccggccggattggtgggggtaggaacatagaccaccacatcctg
cacgtggccacagaagtcatcaaggaatctcgagagctgcggctgcagcccttcaatgag
taccgcaagaggtttggcatgaagccctacacctctttccaggagttcacaggagagaag
gagatggcggctgagttggaggagctatatggagacattgatgccttggagttctacccg
ggactgcttcttgagaagtgccatccaagctccatctttggggagagtatgatagaaatt
ggggctcccttttccctcaagggcctcttagggaatgccatctgttctccagagtactgg
aaggcgagcacgtttggtggtgagatgggcttcaacatcgtcaagacagccacactgaag
aagttggtttgtctcaacaccaagacttgtccctacgtttccttccatgtacccgacccc
caccacaatgacggggctggtgtggagcggccgtccacagagctctga

DBGET integrated database retrieval system