KEGG   Miniopterus natalensis: 107535671Help
Entry
107535671         CDS       T05883                                 

Gene name
TSPAN5
Definition
(RefSeq) tetraspanin-5 isoform X1
  KO
K17345  tetraspanin-5
Organism
mna  Miniopterus natalensis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107535671 (TSPAN5)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107535671 (TSPAN5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tetraspanin
Motif
Other DBs
NCBI-GeneID: 107535671
NCBI-ProteinID: XP_016066679
LinkDB All DBs
Position
Unknown
AA seq 300 aa AA seqDB search
MSGKHYKGPEVSCCIKYFIFGFNVIFWFLGIAFLGIGLWAWNEKGVLSNISSITDLGGFD
PVWLFLVVGGVMFILGFAGCIGALRENTFLLKFFSVFLGIIFFLELTAGVLAFVFKDWIK
DQLYFFINNNIRAYRDDIDLQNLIDFTQEYWQCCGAFGADDWNLNIYFNCTDSNASRERC
GVPFSCCTKDPAEDVINTQCGYDARQKPVSGISSSRLARRVLEELLNLRGDAVLSSPLVK
EVDQQIVIYTKGCVPQFEKWLQDNLTIVAGVFIGIALLQIFGICLAQNLVSDIEAVRASW
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtccgggaagcactacaagggtcctgaagtcagttgttgcatcaaatatttcatattt
ggcttcaatgtcatattttggtttttgggaatagcatttcttggaattggactgtgggcg
tggaatgaaaaaggagttctgtccaacatctcttccatcaccgatctcggcggctttgac
ccagtttggctcttccttgtggtgggaggagtgatgttcattttgggatttgcagggtgc
attggagctctacgggaaaacacgttccttctcaagtttttttctgtgttcctgggaatc
attttcttcctggagctcactgccggcgttctagcatttgttttcaaagactggatcaaa
gaccagctgtatttctttataaacaacaacatcagagcgtacagggatgacattgatttg
cagaacctcatagacttcacccaggaatattggcagtgctgtggggcttttggagctgat
gattggaacctaaatatttacttcaattgcacagattccaatgcaagtcgggagagatgc
ggtgtgcctttctcctgctgcactaaagatcccgcagaagacgtcatcaacactcagtgt
ggctatgatgccaggcaaaaaccagtaagtggaatctcgtcttctcgcttagcacgcagg
gtgttggaggagcttttgaacttgcgtggtgacgctgtgctctcctctccccttgtgaag
gaggtcgaccagcagattgtgatctacacgaaaggctgcgtgccccagtttgagaaatgg
ttgcaggacaacttaaccatcgtggccggtgtattcataggcattgcattgctgcagatt
tttgggatatgtctggctcagaatttggttagcgacattgaagctgtcagggctagctgg
tag

DBGET integrated database retrieval system