KEGG   Miniopterus natalensis: 107535713
Entry
107535713         CDS       T05883                                 

Gene name
STK10
Definition
(RefSeq) serine/threonine-protein kinase 10
  KO
K08837  serine/threonine kinase 10 [EC:2.7.11.1]
Organism
mna  Miniopterus natalensis
Pathway
mna04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107535713 (STK10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107535713 (STK10)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107535713 (STK10)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: STE group
  STE20 family
   107535713 (STK10)
SSDB
Motif
Pfam: PKK Pkinase PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 107535713
NCBI-ProteinID: XP_016066735
LinkDB
Position
Unknown
AA seq 955 aa
STFEKRKSREYEHVRRDLDPNEVWEIVGELGDGAFGKVYKAKNKETGALAAAKVIETKSE
EELEDYIVEIEILATCDHPYIVKLLGAYYYDSKLWIMIEFCPGGAVDAIMLELDRGLTEP
QIQVVCRQMLEALHFLHGKKIIHRDLKAGNVLMTLEGDIRLADFGVSAKNLKTLQKRDSF
IGTPYWMAPEVVMCETMKDTPYDYKADIWSLGITLIEMAQIEPPHHELNPMRVLLKIAKS
DPPTLLTPSKWSVEFRDFLKTALDKNPETRPSAAQLLEHPFVSSVTSNKALRELVAEAKA
EVMEEIEDGRDEGEEEDSVDAASPLGNHTPDSSEASQVSLDADKLLKEPSVTAVPPSPPQ
DSEDEPSQPSGERSLQTTGPPGVAPGGENGLAVPVPLRKSRPVSMGARIQVSEEKQAADQ
AGDLSPAAKRSQKTSQSRPISSALETLGGEKLANGSLELPAPASPRPSKRDSDCVSLSTS
ESMDYSTSLSADLSLNRETGSLSLQDSRLHKKTLKRTRKFVVDGVEVSITTSKIISEDEK
KDEEMRFLRRQELRELRLLQKEEHRNQNQLSRKHELQLEQMHKRFEQEVNAKKKFFDTEL
ENLERQQKQQVEKMEQDHAVRRREEAKRIRLEQERDYTKFQEQLKLMKKEVKNEVEKLPR
QQRKESMKQKLEEHAQKKQHLDRDFLAKQKEDLELAMKRITADNRREICDKERECLTRKQ
ELLRDREAALWDMEEHHLQERHQLVKQQLKDQYFLQRHELVRKHEKEREQMQRYNQRMVE
QLKVRQQQEKARLPKIQRSEGKTRMAMYKKSLHISGSGSAAEQREKIKQFSQQEEKRQKS
ERLQQQQKHENQMRDMLAQCESNMSELQQLQNEKCHLLVEHETQKLKALDESYNQNLKEW
RDRLRPRKKALEEDLNQKKREQEMFFKLSEETECLNPTTPNKATKFFPYSSADAS
NT seq 2868 nt   +upstreamnt  +downstreamnt
tctactttcgagaagagaaagtcccgcgaatatgagcacgtccggcgggacctggacccc
aacgaagtgtgggagatcgtgggcgagctgggcgacggcgccttcggcaaggtttacaag
gccaagaacaaggagacgggtgccttggccgccgccaaggtcatcgagaccaagagtgag
gaggagctggaggactacatcgtggagattgagatcctggccacctgcgaccacccctac
atcgtgaagctcctgggcgcctactactacgacagcaagctgtggatcatgatcgagttc
tgtcctgggggagctgtggatgccatcatgctggagctggaccgtggcctcacggagccc
cagatccaggtcgtttgtcgccagatgctagaagccctccacttcctgcacggcaagaag
atcatccaccgggacctgaaggctggcaacgtgctgatgaccctggagggcgacatcagg
ctggctgactttggtgtgtctgccaagaatctgaaaactctgcagaaacgagattccttc
attggaacgccttactggatggcccccgaggtggtgatgtgtgagaccatgaaggacact
ccctatgactacaaagctgacatctggtccctgggcatcactctgattgagatggcccag
atcgagcccccgcaccacgagctcaatcccatgcgggtcctgctcaagatcgccaagtcg
gacccccccacgctgctcacaccttccaagtggtctgtggagttccgagacttcctgaag
acggcgctggataagaacccggagacccggcccagtgctgcgcagctcctggagcatccc
ttcgtcagcagcgtcaccagtaacaaggccctgcgggagctggtggctgaggccaaggcc
gaggtgatggaggagattgaagacggccgggatgagggggaagaggaggactccgtggac
gccgcctctcctctgggaaaccacactcccgactcttctgaggcgagtcaggtgagcctt
gatgccgacaagcttctcaaggaaccatctgtcactgcagtgccacccagcccgcctcag
gacagtgaggatgagcccagccagccatctggggaaagatctctccaaaccaccggccct
ccaggtgtggcccctggaggtgagaatggcctggctgtgcctgtgcctctccggaagtcc
cggcccgtgtcaatgggtgccagaattcaggtatctgaggagaagcaagccgctgaccag
gctggggacctcagtccagcagccaagcggtcccaaaagacaagtcagagccgtcccatc
agcagcgccctggagaccttgggcggtgagaagctggccaacggcagcctggagctccct
gccccagcatcccctcgcccttccaagagggactcggactgtgtcagcctgtccacctct
gagagcatggactacagcacctccctgtccgccgacctgtccctgaacagagagacgggc
tctctgtccctccaggactcaaggctgcacaagaaaaccctcaagaggacccgcaagttt
gtggtggatggtgtagaggtcagcatcaccacctccaagatcatcagcgaagacgagaag
aaggatgaggagatgagattcctcaggcgccaggaactccgagagcttcggctgctccag
aaagaagagcatcggaaccagaaccagctgagcaggaagcatgagctgcagctggagcag
atgcataaacgttttgaacaagaagtcaacgccaagaagaagttctttgacacagagctg
gagaacctggagcgtcagcaaaagcagcaagtggagaagatggagcaagaccatgctgtg
cgccgccgggaggaggccaagcggatccgcctggagcaggagagggactacaccaagttc
caggagcagctcaagctgatgaagaaggaggtcaagaacgaggtggagaagctccccagg
cagcagcggaaggagagcatgaagcagaagttggaggagcatgcacaaaaaaagcagcat
cttgaccgagacttcctagccaagcagaaggaggacctggagctggcgatgaagaggatc
acggctgacaacaggcgggagatctgtgacaaggagcgcgagtgcctcactaggaagcag
gagctccttcgagaccgggaggcggccctgtgggacatggaggagcatcacctgcaggag
aggcaccagctggtgaagcagcagctcaaagaccagtacttcctccagcggcacgagttg
gtgcgcaagcatgagaaggagcgggagcaaatgcagcgctacaaccagcgcatggtggag
cagctgaaggtgcggcagcagcaggagaaggcgcggctgccaaagatccagaggagcgag
ggcaagacgcgcatggccatgtacaagaagagcctgcatatcagtgggtcgggcagtgcc
gccgagcagcgcgagaagatcaagcagttttcccaacaagaagagaagaggcagaagtcg
gagcggctgcagcagcagcaaaaacatgagaaccagatgcgggacatgttggcacagtgc
gagagcaacatgagtgagctgcagcagctacagaatgaaaagtgtcacctcctggtagag
catgaaacccagaagctgaaggccctggacgagagctataaccagaacctgaaggaatgg
cgggacagacttcggccacgcaaaaaggctctggaagaagatctgaaccagaagaagcgg
gaacaggagatgttcttcaaactgagtgaggagactgagtgcctgaaccctactacccca
aacaaggccaccaagttcttcccctacagctctgcggatgcttcctaa

DBGET integrated database retrieval system