KEGG   Miniopterus natalensis: 107535800Help
Entry
107535800         CDS       T05883                                 

Gene name
SORD
Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
mna  Miniopterus natalensis
Pathway
mna00040  Pentose and glucuronate interconversions
mna00051  Fructose and mannose metabolism
mna01100  Metabolic pathways
Module
mna_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    107535800 (SORD)
   00051 Fructose and mannose metabolism
    107535800 (SORD)
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     107535800 (SORD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 SpoVS
Motif
Other DBs
NCBI-GeneID: 107535800
NCBI-ProteinID: XP_016066868
LinkDB All DBs
Position
Unknown
AA seq 356 aa AA seqDB search
MAAAKPENLSLVVHGPGDLRLENYPIPEPGPNEVLLKMHSVGICGSDVHYWQHGRIGEFV
VKKPMVLGHEASGTVVKVGSSVKHLQPGDRVAIEPGAPRETDEFCKIGRYNLSPSIFFCA
TPPDDGNLCRFYKHNANFCYKLPDNVTFEEGALIEPLSVGIHACRRAGVTLGNKVFVSGA
GPIGLVNLLVAKAMGAAQVVVTDLSASRLAKAKEVGADFTLQVSKESPQEIASKVEGLLG
RKPEVTVECTGAEAAIQAGIYATCSGGTLVLVGLGSEMASVPLVHAAIREVDIKGVFRYC
NTWPMAISMLASKSVNVKPLVTHRFPLENALEAFETSRKGLGLKVMIKCDPNNQNP
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccaagcccgagaacctttccctggtggtgcacggacccggggacctgcgc
ctggagaactatcctatcccagaaccaggcccaaacgaggtgctgctgaagatgcattcc
gttgggatctgcggctcagacgtccactactggcagcatggtcgaattggggagtttgtt
gtgaaaaaaccaatggtgctgggccatgaagcttcaggaacagtcgtaaaagtgggatca
tcggtaaagcacctgcaaccaggtgatcgtgttgccatcgagcctggtgctcctcgggaa
accgatgaattctgcaagattggccgatacaacctgtcaccatccatcttcttctgtgcc
acgccccccgatgatgggaacctctgccggttctataagcacaatgccaacttctgttac
aagcttcctgacaatgtcacctttgaggaaggggccctgattgagccactgtctgtgggg
atccacgcctgccggcgcgctggagtcaccttggggaacaaggtgtttgtgagtggagct
gggccaattggactggtcaatttgctcgtggccaaggcaatgggtgcagctcaagtggtg
gtgactgatctgtctgcgtctcgattggctaaagccaaggaagtcggggctgactttacc
ctccaggtgtccaaggagagccctcaggaaatcgccagtaaagtggaaggtctcctgggg
cgcaagcccgaggtcacggtggagtgcacgggggcggaggccgccatccaggcgggcatc
tacgccacttgttctggtgggaccctggtccttgtgggactgggttccgagatggcctct
gtccccttagtgcacgcagccatccgggaagtggatatcaagggcgtgtttcgatactgc
aacacatggccaatggcgatttcaatgcttgcatccaagtctgtgaatgtaaagccctta
gtgacccataggtttcctctggagaatgcgctggaggcctttgaaacatccagaaaggga
ttgggtttgaaagtcatgatcaagtgtgaccctaacaaccagaatccctga

DBGET integrated database retrieval system