KEGG   Miniopterus natalensis: 107535809
Entry
107535809         CDS       T05883                                 

Gene name
PKMYT1
Definition
(RefSeq) membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase
  KO
K06633  membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase [EC:2.7.11.1]
Organism
mna  Miniopterus natalensis
Pathway
mna04110  Cell cycle
mna04114  Oocyte meiosis
mna04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107535809 (PKMYT1)
   04114 Oocyte meiosis
    107535809 (PKMYT1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107535809 (PKMYT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107535809 (PKMYT1)
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107535809 (PKMYT1)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107535809 (PKMYT1)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: Other
  WEE family
   107535809 (PKMYT1)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107535809 (PKMYT1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 107535809
NCBI-ProteinID: XP_016066872
LinkDB
Position
Unknown
AA seq 491 aa
MPVPTEGTPPPLSGTPTPVPAYFRHAEPGFSLKRPRGLSQSLPPRPPAKGNIPISRLFPP
RTPGWHQPQPRRVSFQDKASEILQSPSYDPSRQESFFQQSFQRLGRLGHGSYGEVFKVRS
KEDGQLYAIKRSMSPFRGPKDRARKLAEVSSHEKVGQHPCCVRLERAWEEGGILYLQTEL
CGPSLQQHCETWGTGLPEAQVWGYLRDTLLALAHLHGQGLVHLDIKPANIFLGPRGRCKL
GDFGLLVELDASGPGEAQEGDPRYMAPELLQGSYGTAADVFSLGLTILEVACNMELPHGG
EGWQQLRQGYLPPEFTASLSSELRSVLIMMLEPDPKLRATAEALLALPMLRQPQPWSVLW
YMAAEALSRGWALWQALLALLCWLWHGLAHPASWLQPLRPPATPPGSPPCSFLLDSSHSS
NWDDDSIGPSLSPEAILARAARSTSSTPQSRHTLRDTLDLSDIDSEPPQGSFPSFEPRNL
LSLFEDSLGPT
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgcctgtgcccacagagggcactccgccacccctgagtggcacccccaccccagtccca
gcctacttccgccatgcagaacctggtttttccctcaagaggcccagggggcttagtcag
agccttccgccccggccccctgccaagggcaacatccccatcagtcgcctcttccctcct
cggaccccaggctggcaccagccccaaccccgaagggtatcatttcaagacaaagcctct
gagatcctacagagccccagttatgacccaagccggcaggagtccttcttccagcagagt
ttccagaggcttggccgcctgggccatggctcttatggagaggtcttcaaggtacgttcc
aaggaagatggccagctctatgcaataaagcgctccatgtcgccattccggggccccaag
gaccgagcccgaaagctggctgaggtcagcagccatgagaaggtggggcagcacccatgc
tgtgtgcggctggaacgagcctgggaggagggtggcatcctgtacctgcagacagagctg
tgtgggcccagcctgcagcagcactgtgagacctggggcactggcctgcctgaggcccag
gtctggggctacctgcgggataccctcctcgctctggcccacctgcatggccaaggcctg
gtccaccttgacatcaagcctgccaacatctttctggggccccggggccgctgcaaactg
ggtgactttgggctgctggtggagctggatgcatctgggcctggtgaggcgcaggaggga
gacccccgctacatggcccccgagctgctgcagggctcctacgggacagcagccgacgtg
ttcagtctgggtctcaccatcctggaagtggcatgcaacatggagctgccccatggtgga
gagggctggcagcagctgcgccagggctacctgccccccgagttcactgccagcctgtct
tctgagctgcggtctgtcctcatcatgatgctggagcctgatcccaagctgcgggccaca
gctgaggccctgctggccctgcctatgctcaggcagccacagccctggagtgtcctgtgg
tacatggctgctgaagccctgagtcgagggtgggccctgtggcaggccctgctggctctg
ctgtgctggctctggcatgggctggctcaccctgccagctggctgcagcccctgaggccc
ccggctactcctcctggctcaccgccctgcagcttcctcctggacagcagccactccagc
aactgggatgacgacagcatagggccctcgctctctccagaggccatcctggccagggct
gccaggagcacctcctccactccccagagcagacacacactgagggataccctagaccta
agtgacattgactctgagccccctcagggctccttcccctcctttgagcctcggaacctc
cttagcctgtttgaggactcactgggcccaacctga

DBGET integrated database retrieval system