KEGG   Miniopterus natalensis: 107535907
Entry
107535907         CDS       T05883                                 

Gene name
ROCK1
Definition
(RefSeq) rho-associated protein kinase 1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
mna  Miniopterus natalensis
Pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04062  Chemokine signaling pathway
mna04071  Sphingolipid signaling pathway
mna04270  Vascular smooth muscle contraction
mna04350  TGF-beta signaling pathway
mna04360  Axon guidance
mna04510  Focal adhesion
mna04530  Tight junction
mna04611  Platelet activation
mna04670  Leukocyte transendothelial migration
mna04810  Regulation of actin cytoskeleton
mna04921  Oxytocin signaling pathway
mna05135  Yersinia infection
mna05163  Human cytomegalovirus infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    107535907 (ROCK1)
   04071 Sphingolipid signaling pathway
    107535907 (ROCK1)
   04024 cAMP signaling pathway
    107535907 (ROCK1)
   04022 cGMP-PKG signaling pathway
    107535907 (ROCK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107535907 (ROCK1)
   04530 Tight junction
    107535907 (ROCK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107535907 (ROCK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107535907 (ROCK1)
   04670 Leukocyte transendothelial migration
    107535907 (ROCK1)
   04062 Chemokine signaling pathway
    107535907 (ROCK1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107535907 (ROCK1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107535907 (ROCK1)
  09158 Development and regeneration
   04360 Axon guidance
    107535907 (ROCK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107535907 (ROCK1)
   05206 MicroRNAs in cancer
    107535907 (ROCK1)
   05205 Proteoglycans in cancer
    107535907 (ROCK1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107535907 (ROCK1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107535907 (ROCK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107535907 (ROCK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107535907 (ROCK1)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107535907 (ROCK1)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   107535907 (ROCK1)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    107535907 (ROCK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Rho_Binding PH C1_1 FPP HR1 APH Pkinase_C DUF1192
Other DBs
NCBI-GeneID: 107535907
NCBI-ProteinID: XP_016066991
LinkDB
Position
Unknown
AA seq 1354 aa
MSTGDSFETRFEKIDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYK
DTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFP
DDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLS
SDIDTSNFDDLEEDKGDEETFPIPKAFVGNQLPFVGFTYYSNRRYLSSANPNDNRASSNA
DKSLQESLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNIKLDKIMKELDEEGNQRRNLEST
VSQIEKEKMLLQHRINEYQRKAEQENEKRRNVENEVSTLKDQLEDLRKVSQNSQHANEKV
AQLQKQLEEANDLLRTESDTAVRLRKSHTEMSKSISQLESLNRELQERSRILENSKSQTD
KEFYQLQAALEAERRDRGHDSEMIGDLQARITSLQEEVKHLKHNLERVEEERKEAQDMLN
HSEKEKNNLEIDLNYKLKSLQQRLEQEVNEHKVTKARLTDKHQSIEEAKSVAMYEMEKKL
KEEREAREKAENRVVQIEKQCSMLDVDLKQSQQKLEHLTESKERMEDEVKNLTLQLEQES
NKRLLLQNELKTQAFEADNLKGLEKQMKQEINTLLEAKRLLEFELAQLTKQYRGNEGQMR
ELQDQLEAEQYFSTLYKTQVKELKEEIEEKNRENLKKIQELQNEKETLVTQLDLAETKAE
SEQLARGLLEEQYFELTQESKKAASRNRQEITDKDHTLSRLEEMNSMLTKDVDLLRKENE
ELTDKMRKSEEEYKLKKEEEISNLKAAFEKNINTERTLKTQAVNKLAEIMNRKDFKIDRK
KANTQDLRKKEKENRKLQLELNQEREKFNQMVVKHQKELNDMQAQLVEECTHRNELQMQL
ASKESDIEQLRAKLLDLSDSTSVASFPSADETDGNLPESRIEGWLSIPNRGNIKRYGWKK
QYVVVSSKKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILY
ANEGECRKDVEMEPVQQAEKTNFQNHKGHEFIPTLYHFPANCEACAKPLWHVFKPPPALE
CRRCHVKCHRDHLDKKEDLISPCKVSYDVTSARDMLLLACSQDEQKKWVTHLVKKIPKNP
PSGFVRASPRTLSTRSTANQSFRKVVKNTSGKTR
NT seq 4065 nt   +upstreamnt  +downstreamnt
atgtcgactggggacagttttgagactcggtttgaaaaaatcgacaacctgctgcgagat
cccaaatcggaagtgaattctgattgtttgctggatggattggatgctttggtatatgat
ttggattttcctgccttaagaaaaaacaaaaatattgacaactttttaagcagatataaa
gacacaataaataaaattagagatttacgaatgaaagccgaagattatgaagtagtgaag
gtgattggcagaggtgcatttggagaagttcaattggtaaggcataaatccaccaggaag
gtatatgctatgaagcttctcagcaaatttgaaatgattaagagatctgattctgctttt
ttctgggaagaaagggacatcatggcttttgctaacagcccttgggttgttcagcttttt
tatgcattccaagatgaccgttatctctacatggtgatggaatacatgcctggtggagat
cttgtaaacttaatgagcaactatgatgtgcctgaaaaatgggcacgattctatactgca
gaagttgtccttgcattagatgcgatccattccatgggttttattcatagagatgtgaag
cctgataacatgctgctggataaatctggacatttgaagttagccgattttggtacttgt
atgaagatgaataaggaaggtatggtacgatgtgatacagcagttggaacacctgattat
atttcccctgaagtattaaaatctcaaggtggtgatggttattatggacgagaatgtgac
tggtggtcagttggggtatttttatatgaaatgcttgtaggtgatacacctttttatgca
gattctctggttggaacttacagtaagattatgaaccataaaaattcacttaccttccct
gacgataatgacatatcaaaagaagcaaaaaatcttatttgtgccttccttactgacaga
gaggtgagattagggcgaaatggtgtagaagaaatcaaacgacacctcttcttcaaaaat
gatcagtgggcttgggaaacacttcgagacactgtagcaccagttgtacctgatttgagt
agtgacattgatacaagtaactttgatgacttggaagaagataaaggagatgaggaaaca
ttccctatacctaaagcttttgttggcaatcaactaccttttgtaggatttacatattat
agcaatcgtagatacttatcttcagcaaatcctaatgataacagagctagctccaatgcg
gataaaagcttgcaggaaagtttgcaaaaaacaatttataagctggaagaacagctgcat
aatgaaatgcaattaaaagatgaaatggagcagaagtgcagaacttcaaacattaaacta
gacaaaataatgaaagaattggatgaagaggggaatcaaagaagaaatctagaatctaca
gtgtctcagattgaaaaagaaaagatgttgctacagcatagaattaatgagtaccaaaga
aaagcagaacaggaaaatgaaaagaggagaaatgtagaaaatgaagtttctacattaaag
gatcagttggaagacttaaggaaagtaagtcagaattcacagcatgctaatgagaaggtg
gcacaattacaaaagcagctggaagaagccaatgacttacttaggacagaatcagacaca
gctgtaagattaaggaagagtcacacagagatgagcaagtcaattagtcagctagagtcc
ctgaacagagaattgcaggagagaagtagaattttagagaattccaagtcacaaacggac
aaggagttttaccagctgcaagctgcattagaagctgaacgaagagacagaggtcatgat
tctgagatgattggagaccttcaagctcgaattacatctttacaagaggaggtgaagcat
ctcaaacataatcttgaaagagtagaagaagaaagaaaagaggctcaagacatgcttaat
cattcagaaaaggaaaagaataatttagagatagatttaaactataagcttaaatcgtta
caacaacggttagaacaagaggtaaatgaacataaagtaaccaaagctcgtttaactgac
aaacatcaatctattgaagaagcaaagtctgttgcaatgtatgagatggaaaaaaagctg
aaggaagagagagaagctcgagagaaggctgaaaatagggttgttcagattgagaaacag
tgttccatgctagatgttgatctgaaacaatctcagcagaagctggagcatttgactgaa
agtaaagaaagaatggaggatgaagttaagaatctcactctgcagttggaacaggaatca
aataagagactgttgttacagaatgaattgaagactcaagcatttgaggcagacaattta
aaaggtctagaaaagcagatgaaacaggaaataaatactttactggaagcaaagagatta
ttagaatttgagttagctcagcttacaaaacaatatagaggaaatgagggacagatgcgg
gaactgcaagaccaacttgaagctgagcaatatttctcgacactttataaaacccaggta
aaggaacttaaggaagaaattgaagaaaaaaacagagaaaatttaaagaaaatacaggaa
ctacaaaatgagaaagagactcttgttactcagttggatctagcagaaacaaaagctgaa
tctgagcagttggctcgagggcttttagaagaacagtactttgaattgacccaagaaagc
aagaaagctgcttcaagaaatagacaagagattacagataaagatcacactcttagtcgg
ctcgaggaaatgaacagcatgctaaccaaagatgttgacttactaagaaaagaaaatgaa
gagctaactgataaaatgaggaaatcagaggaagagtataaactgaagaaagaggaggag
atcagtaatcttaaggctgcctttgaaaagaatattaatacagaacgaacacttaaaaca
caggctgttaacaagttggcagaaataatgaatcgaaaagattttaaaattgatagaaag
aaagctaatacacaggatttgaggaagaaagaaaaggaaaatcgaaagctacagctggaa
ctcaaccaagaaagagagaaattcaaccagatggtagtgaaacatcagaaggaactgaat
gacatgcaagcgcaattggtagaagaatgtacacataggaatgagcttcagatgcagttg
gctagcaaagagagtgatatcgagcaattgcgtgctaaacttttggacctttcggattct
acgagtgttgctagttttcctagtgctgatgaaactgatggaaaccttccagagtcaaga
attgaaggttggctttcaataccaaatagaggaaatatcaaacgatatggctggaagaaa
cagtatgttgtggtaagcagcaaaaaaattttgttttataatgatgaacaagataaggag
caatccaatccatctatggtattggacatagataaattgtttcatgttcgacctgtaacc
caaggagatgtgtacagggccgaaactgaagaaattcctaaaatattccagatactatat
gcaaatgaaggtgaatgtagaaaagatgtagagatggaaccagtacaacaagctgaaaaa
actaattttcaaaatcacaaaggccatgagttcattcctacgctctaccactttcccgcc
aactgtgaggcctgtgccaaacctctatggcatgtttttaagccaccccctgccctagaa
tgtcgaagatgccatgttaagtgccacagagatcacttagataagaaagaggacttaatt
tctccatgtaaagtaagttatgatgtaacatcagcaagagatatgctgttgttagcatgt
tctcaggatgaacaaaaaaaatgggtaactcatttagtaaagaagatacctaagaatccg
ccatctggttttgttcgtgcatcccctcgaacactttctacaagatccactgcaaatcag
tctttccggaaagtggtcaaaaatacatctggaaaaactaggtaa

KEGG   Miniopterus natalensis: 107542396
Entry
107542396         CDS       T05883                                 

Gene name
ROCK2
Definition
(RefSeq) rho-associated protein kinase 2 isoform X1
  KO
K17388  Rho-associated protein kinase 2 [EC:2.7.11.1]
Organism
mna  Miniopterus natalensis
Pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04062  Chemokine signaling pathway
mna04071  Sphingolipid signaling pathway
mna04270  Vascular smooth muscle contraction
mna04310  Wnt signaling pathway
mna04360  Axon guidance
mna04510  Focal adhesion
mna04530  Tight junction
mna04611  Platelet activation
mna04670  Leukocyte transendothelial migration
mna04810  Regulation of actin cytoskeleton
mna04921  Oxytocin signaling pathway
mna05132  Salmonella infection
mna05135  Yersinia infection
mna05163  Human cytomegalovirus infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107542396 (ROCK2)
   04071 Sphingolipid signaling pathway
    107542396 (ROCK2)
   04024 cAMP signaling pathway
    107542396 (ROCK2)
   04022 cGMP-PKG signaling pathway
    107542396 (ROCK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107542396 (ROCK2)
   04530 Tight junction
    107542396 (ROCK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107542396 (ROCK2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107542396 (ROCK2)
   04670 Leukocyte transendothelial migration
    107542396 (ROCK2)
   04062 Chemokine signaling pathway
    107542396 (ROCK2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107542396 (ROCK2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107542396 (ROCK2)
  09158 Development and regeneration
   04360 Axon guidance
    107542396 (ROCK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107542396 (ROCK2)
   05205 Proteoglycans in cancer
    107542396 (ROCK2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107542396 (ROCK2)
   05135 Yersinia infection
    107542396 (ROCK2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107542396 (ROCK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107542396 (ROCK2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107542396 (ROCK2)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107542396 (ROCK2)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   107542396 (ROCK2)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    107542396 (ROCK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Rho_Binding PH C1_1 APH
Other DBs
NCBI-GeneID: 107542396
NCBI-ProteinID: XP_016075194
LinkDB
Position
Unknown
AA seq 1412 aa
MGNLVLRLSSLKDGLNSLVLDLDFPALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVV
KVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQL
FCAFQDDKYLYMVMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDV
KPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEVLKSQGGDGYYGREC
DWWSVGVFLFEMLVGDTPFYADSLVGTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTD
REVRLGRNGVEEIKQHPFFKNDQWNWDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVE
TFPIPKAFVGNQLPFIGFTYYRENLLLSDFPSCRENDSVQSRKNEESQEIQKKLYTLEEH
LSTEIQAKEEIEQKCKSANTRLEKVSKELEEEITLRKNAESALRQLEREKALLQHKNAEY
QRKADHEADKKRNLENDVNSLKDQLEDLKKRNQSSQISTEKVNQLQKQLDETSALLRTES
DTSARLRKSQAESSKQIQQLESNNRDLQDKNCLLETAKLKLEKEFINLQSILESERRDRT
HGSEIINDLQGRISGLEEDVKNGKILLAKVEMEKRQLQERFTDLEKEKNNLEIDMTYQLK
VIQQSLEQEEAEHKTTKARLADKNKIYESIEEAKSEAMKEMEKKLLEERTLKQKVENLLL
EAEKKCSILDCDLKQSQQKINELLKQKDVLNEDVRNLTLKIEQETQKRCLTQNDLKMQTQ
QVNTLKMSEKQLKQENNHLMEMKMNLEKQNGELRKERQDADGQMKELQDQLEAEQYFSTL
YKTQVRELKEECEEKTKLCKELQQKKQELQDERDSLAAQLEITLTKADSEQLARSIAEEQ
YSDLEKEKIMKELEIKEMMARHKQELSEKDATIASLEETNRTLTSDVANLANEKEELNNK
LKDAQEQLSRLKDEEISAAAIKAQFEKQLLTERTLKTQAVNKLAEIMNRKEPIKRGSDTD
VRRKEKENRKLHMELKSEREKLTQQMIKYQKELNEMQAQIAEESQIRIELQMTLDSKDSD
IEQLRSQLQALHMGMDSSSIGSGPGDAEADDGFPVHITQSHTMESMSFTYQRSSASLSIA
TKPSSSHVLLGSDSDSEEESLPYLPISSEPSDTESRLEGWLSLPVRNNTKKFGWVRKYVI
VSSKKILFYDSEQDKEHSNPYMVLDIDKLFHVRPVTQTDVYRADAKEIPRIFQILYANEG
ESKKEQEFPVEPVGEKSNYICHKGHEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRC
HIKCHKDHMDKKEEIIAPCKVYYDISTAKNLLILANSTEEQQKWVSRLVKKIPKKPPAPD
PFARSSPRTSMKIQQNQSVRRPSRQLAPNKPS
NT seq 4239 nt   +upstreamnt  +downstreamnt
atgggaaatttagttttgaggctgagttctctgaaggatggcttaaattccttggtcctt
gatttggattttcctgctttgaggaaaaacaagaatatagataatttcttaaacagatat
gagaaaattgtgaaaaaaatcagaggtctacagatgaaggcagaagactatgatgttgta
aaagttattggaagaggtgcttttggtgaagtccagttggttcgtcataaagcgtcacag
aaggtttatgctatgaagcttcttagtaagtttgaaatgattaaaagatcagattctgct
tttttctgggaagaaagagatattatggcctttgccaacagtccctgggtggttcagctc
ttttgtgcttttcaagatgataagtatctgtacatggtaatggagtacatgcctggtgga
gaccttgtaaaccttatgagtaactatgatgtacctgaaaaatgggccaaattttatact
gctgaagttgttcttgccctggatgccatacactccatgggcttaattcacagagatgtg
aagcctgacaacatgcttttggataaacatggacatctaaaattagcagattttggcaca
tgtatgaagatggatgaaacaggcatggtgcattgtgatacagcagttggaacacctgat
tatatatcacccgaggttctaaaatcacaagggggcgatggctactatgggcgagaatgc
gattggtggtctgtgggtgttttcctttttgagatgctggtgggggatactccattttat
gcagattcacttgtaggaacatatagcaaaattatggatcataagaactcactatgtttc
cctgaagatgcagaaatctctaaacatgcgaagaatctcatctgtgccttcctaacagat
agggaggtacgacttgggagaaatggggtagaagaaatcaaacaacatcctttctttaag
aatgatcaatggaattgggataacataagagagacggcggctccagtagtacctgaactc
agcagtgacatagacagcagcaattttgatgacattgaagatgataaaggagatgtagaa
accttcccaattcctaaagcttttgtgggaaatcagctgccctttataggatttacctac
tacagagaaaatttgttattaagtgactttccatcttgtagagaaaatgattcagtacaa
tcaagaaaaaatgaagaaagtcaagagattcagaaaaaactgtacacattagaagaacac
cttagcactgagatacaagccaaagaggaaatagagcagaagtgcaaatctgctaatact
cgcctagagaaagtatcaaaggaactagaagaagagattaccttaaggaaaaatgcggaa
tcagcattaagacaattagaaagagagaaggcacttcttcagcacaaaaatgcagaatat
cagaggaaagctgatcacgaagcagacaagaaacgaaatttggaaaatgatgttaacagt
ttaaaagatcaacttgaagatttgaaaaaaagaaaccagagctctcaaatatccactgag
aaagtgaatcagctccagaaacaactggatgaaaccagtgctttgctgcgaacagagtct
gatacttcagcccggttaagaaaaagccaggcagaaagttcaaaacagattcagcagttg
gaatctaacaacagagatctacaagataaaaattgcctgttggagactgccaagttaaaa
ctcgaaaaggaatttatcaatcttcagtcgattctagaatctgaaaggagggaccgaacc
catggatccgagataattaatgatttacaaggtagaatatctggcctagaagaagatgta
aagaatggcaaaatcttattagcaaaagtagagatggagaagagacaactacaggagaga
ttcactgatttggaaaaggagaagaacaacctggagatagatatgacataccagctgaaa
gttatacagcagagcttagaacaagaagaagccgagcacaagactacaaaagcacggctg
gcagataaaaataagatctacgaatccattgaagaagccaaatcagaagccatgaaagaa
atggaaaaaaagctcttggaggaaaggactttaaaacagaaagtggagaacctattgctg
gaagctgagaaaaaatgctctatattagactgtgacctcaaacagtcacagcagaaaata
aatgaactccttaagcagaaagatgtgctaaatgaagatgttagaaacttgacattaaaa
atagagcaggaaactcaaaagcgctgcctcacacaaaatgacttgaagatgcaaacacag
caagttaacacactaaaaatgtcagaaaagcagttaaaacaagagaataatcatctcatg
gaaatgaaaatgaacttggaaaaacagaatggtgaacttcgaaaagaacgtcaagacgcg
gatgggcaaatgaaagagctccaagatcagcttgaagcagaacagtatttctccaccctc
tataaaacacaggttagggaactgaaagaagagtgtgaagaaaagaccaaactttgtaaa
gaattacagcagaagaaacaggaactacaggatgaaagggactccttggctgcacagctg
gagatcaccttgaccaaagcagattctgagcagctggctcgttcaattgctgaagaacag
tattctgatttggagaaagagaaaatcatgaaagagctggagatcaaagagatgatggca
aggcacaaacaggaactcagtgagaaagatgctacaattgcatcccttgaagaaactaac
aggacactaactagtgatgttgccaatcttgcaaatgagaaagaagaattaaataacaaa
ttgaaagatgcccaagaacaactatcaaggttgaaagacgaagagataagcgcagcagct
attaaagcacaatttgagaagcagctactaacagagagaacactcaaaactcaagctgtg
aataagttggctgagatcatgaatcgaaaagaacctatcaagcgtggtagtgacacagat
gtgcggagaaaagagaaggagaatagaaagctacatatggagcttaaatctgaacgtgaa
aaattgacccagcagatgatcaaatatcagaaagaactgaatgaaatgcaggctcaaata
gctgaagagagccagattcgaattgaactacagatgacactggacagcaaggacagtgac
attgagcagctgcggtcacagctccaggccttacacatgggtatggacagttccagcata
ggcagtggaccaggggacgctgaggcagatgatggcttcccagttcatatcactcagtca
cacactatggaatccatgtcattcacctaccaacgttcctctgcctctctcagtattgcc
actaagccttccagctctcatgtgcttcttggctctgattctgactcagaagaagaatct
ttgccttacttacctatttcatcggaacctagtgatacagagtcaagactagagggatgg
ctctcattgcctgtgagaaacaacactaagaagtttgggtgggttagaaagtatgtgatc
gtcagcagtaagaagattcttttctatgacagtgaacaggataaagaacattctaatcct
tacatggttttagatatagacaaattgtttcatgtccgaccagttacacagacagatgta
tacagagcagatgctaaagaaattccaaggatatttcagattctgtatgccaatgaagga
gaaagtaagaaggaacaagaatttccagtggagccagtgggagaaaagtcaaattatatt
tgccacaaaggacatgaatttattcctactctctatcatttcccaaccaactgtgaggct
tgtatgaagcccttgtggcatatgttcaaacctcctcctgctttggagtgccgtcgctgc
catattaaatgtcataaagaccacatggacaaaaaggaggagattatagctccttgcaaa
gtgtattatgatatttcaacggcaaagaatctgttgatattagcaaattctacagaagag
cagcaaaagtgggttagtcggttggtgaaaaagatacctaaaaagcctccagctccagac
ccttttgcacggtcgtctcctagaacttcaatgaagatacagcaaaaccagtctgttaga
cggccaagtcgacagcttgccccaaataaaccaagctaa

DBGET integrated database retrieval system