KEGG   Miniopterus natalensis: 107535925
Entry
107535925         CDS       T05883                                 

Gene name
PDIA3
Definition
(RefSeq) protein disulfide-isomerase A3
  KO
K08056  protein disulfide-isomerase A3 [EC:5.3.4.1]
Organism
mna  Miniopterus natalensis
Pathway
mna04141  Protein processing in endoplasmic reticulum
mna04612  Antigen processing and presentation
mna05163  Human cytomegalovirus infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107535925 (PDIA3)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    107535925 (PDIA3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107535925 (PDIA3)
   05168 Herpes simplex virus 1 infection
    107535925 (PDIA3)
   05163 Human cytomegalovirus infection
    107535925 (PDIA3)
   05169 Epstein-Barr virus infection
    107535925 (PDIA3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mna03110]
    107535925 (PDIA3)
   04131 Membrane trafficking [BR:mna04131]
    107535925 (PDIA3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107535925 (PDIA3)
Enzymes [BR:mna01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     107535925 (PDIA3)
Chaperones and folding catalysts [BR:mna03110]
 Protein folding catalysts
  Protein disulfide isomerase
   107535925 (PDIA3)
Membrane trafficking [BR:mna04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    107535925 (PDIA3)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   107535925 (PDIA3)
  Exosomal proteins of colorectal cancer cells
   107535925 (PDIA3)
  Exosomal proteins of bladder cancer cells
   107535925 (PDIA3)
SSDB
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 Thioredoxin_8 Thioredoxin_7 OST3_OST6 AhpC-TSA Thioredoxin_3
Other DBs
NCBI-GeneID: 107535925
NCBI-ProteinID: XP_016067019
LinkDB
Position
Unknown
AA seq 505 aa
MRLRRLALFPGVALLLTAARLTSASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHC
KRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRT
ADGIVSHLKKQAGPASVPLRTEEEFEKFIGDKDASVVGFFKDLFSEAHSEFLKAASNLRD
NYRFAHTNVESLVNKYDDNGEGITLFRPSHLMNKFEDKTSAYTEQKMTSGKIKKFIQENI
FGMCPHMTEDNKDLLQGKDLLVAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGHKLNFA
VASRKTFSHELSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGS
LKRYLKSEPIPESNDGPVKVVVAENFDEIVNDVNKDVLIEFYAPWCGHCKNLEPKYKELG
EKLRKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKLDPKKYEGGRELSDFISYL
QREATNPPIIQEEKPKKKKKAQEDL
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgcgcctccgccgcctagcactgtttccgggcgtggcgctgcttctcaccgcggcccgc
ttaactagtgcctccgacgtgctggaactcacggacgacaacttcgagagtcgcatctcc
gacacgggctctgcgggcctcatgctcgtcgagttcttcgccccctggtgtggacactgc
aagagacttgcccctgagtatgaagctgcagctaccagattaaaaggaatagtcccatta
gcaaaggttgattgtactgccaacacaaacacctgtaataagtatggagtcagtggctat
ccaaccctgaagatatttagagatggtgaagaagcaggtgcttatgatgggcccaggact
gctgatggaattgtcagccacctgaagaagcaggcaggaccagcttcagttcctctcagg
actgaggaagaatttgagaagttcattggtgataaagatgcttctgtagtgggttttttc
aaggatttattcagtgaagctcactctgagtttctaaaagcagccagcaacctgagggat
aactatcgatttgcacacaccaatgttgaatctctggtgaacaagtatgatgataatgga
gagggcatcaccttgtttcgtccctcacacctgatgaacaagtttgaggacaaaacttcg
gcatatacagaacagaaaatgaccagtggcaagattaaaaaatttatccaggaaaacatt
tttggtatgtgccctcacatgacagaagataataaagacttgctacagggcaaggactta
cttgtggcttactatgatgtggactatgaaaagaatgctaaaggttccaactactggaga
aacagggtgatgatggtagcaaagaaattcctggatgctggacacaaacttaactttgcc
gtagctagccgcaaaacctttagccatgaactttccgattttggtttggaaagcactgct
ggagagattcctgttgttgctatcagaactgctaaaggagagaagtttgtcatgcaggaa
gagttctcgcgtgatggcaaggctcttgagagattcctgcaggattatttcgatggcagc
ctaaagcgatacctaaagtctgagccaatcccagagagtaacgatgggcctgtaaaggta
gtggtagcagagaattttgatgaaatagtgaatgatgtaaataaagatgtgctaattgaa
ttttatgctccttggtgtggccactgtaagaatctagaaccgaagtataaagaactggga
gagaagctccgaaaagacccaaatattgtcatagccaaaatggatgccacagccaatgat
gtgccttctccatatgaagtcagaggttttcctaccatctacttctctccagccaacaag
aagctagatccaaagaaatacgaaggtggccgtgaattaagtgattttattagctatcta
cagcgagaagctacaaaccctcctataattcaagaagaaaaacccaagaagaagaagaag
gcacaggaggatctctaa

DBGET integrated database retrieval system