KEGG   Miniopterus natalensis: 107535960
Entry
107535960         CDS       T05883                                 

Gene name
IYD
Definition
(RefSeq) iodotyrosine deiodinase 1 isoform X1
  KO
K17231  iodotyrosine deiodinase [EC:1.21.1.1]
Organism
mna  Miniopterus natalensis
Pathway
mna04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    107535960 (IYD)
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.21  Catalysing the reaction X-H + Y-H = X-Y
   1.21.1  
    1.21.1.1  iodotyrosine deiodinase
     107535960 (IYD)
SSDB
Motif
Pfam: Nitroreductase TM1586_NiRdase
Other DBs
NCBI-GeneID: 107535960
NCBI-ProteinID: XP_016067034
LinkDB
Position
Unknown
AA seq 289 aa
MFPLTPVLIAVVCILIVWIFKNADGNIERRKGEARAKSEARPWVDEDLKDSTDLHQVEED
ADEWQESEETVEHVPFSHTRYPEKEMVTRSQEFYELLNKRRSVRFISNEQVPMEVIDNVI
KTAGTAPSGAHTEPWTFVVVRDPGMKHKVREVIEEEEEVNYLKRMGQRWVTDLKKLRTNW
IKEYLDTAPVLILIFKQVHGFTANGKRKIHYYNEISVSIACGILLAALQNAGLVTVTTTP
LNCGPRLRVLLSRPANEKLLMLLPVGYPSKEATVPDLKRKPLDQIMVTV
NT seq 870 nt   +upstreamnt  +downstreamnt
atgtttcccctgactccagtcttgatagcagttgtctgcattttgattgtgtggatcttt
aaaaatgctgatggaaacatcgagagaaggaaaggggaggcgagagccaagtcggaggct
cgaccctgggtggatgaagacttaaaggacagcactgacctccaccaggtggaagaagac
gctgatgagtggcaggagtcagaggaaaccgttgagcacgtcccattctcccacacccgg
taccctgagaaggaaatggtcacgcgatcccaggaattttatgagctgctcaataagagg
cgctctgtgcgattcataagtaatgagcaagtcccaatggaagtcattgacaatgtcatc
aaaacagcaggaacggccccgagcggggcgcacacggagccctggaccttcgtggtcgtg
agggaccccggcatgaagcataaggtccgggaggtcatcgaagaggaggaggaggtcaat
tacctgaagaggatgggccagcgatgggtcacagacctgaagaaactgagaacgaattgg
attaaagagtacttggacactgctcctgttttaattctcattttcaaacaagtgcatggt
tttactgccaatggcaagagaaagatccactactacaatgagatcagtgtctccatcgcc
tgtggcatcctcctcgctgccctgcagaacgcgggactggtgactgtcaccaccactcct
ctcaactgtggcccccgtctgagggtgctcctgagccgccccgcaaatgaaaagctgctg
atgttgctccccgtgggataccccagcaaagaggccacagtgcccgacctaaaacggaag
cctctggatcagatcatggtgactgtgtag

DBGET integrated database retrieval system