KEGG   Miniopterus natalensis: 107535978
Entry
107535978         CDS       T05883                                 

Definition
(RefSeq) troponin T, cardiac muscle-like
  KO
K12045  troponin T, cardiac muscle
Organism
mna  Miniopterus natalensis
Pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna05410  Hypertrophic cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107535978
   04261 Adrenergic signaling in cardiomyocytes
    107535978
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107535978
   05414 Dilated cardiomyopathy
    107535978
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107535978
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Troponins
     107535978
SSDB
Motif
Pfam: Troponin AAA_21
Other DBs
NCBI-GeneID: 107535978
NCBI-ProteinID: XP_016067057
LinkDB
Position
Unknown
AA seq 217 aa
MSDTEEAVEEYEGEQEEQEEAADEVTAGEEAEAEAEAEATTADDNRQEEEVKEAEDGPVE
ESKPKPRPFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQTLIEAHFENRKKEEEELI
SLKDRIEKRRAERAEQQRIRSEREKERQARLAEERARREEEESRRRAEDEARKKKALSNM
MHFGGYIQKEQPQFSASSSSCSPGTQQCLSATDPPPT
NT seq 654 nt   +upstreamnt  +downstreamnt
atgtctgacacagaagaggcggtggaggagtacgagggggagcaggaagagcaggaagag
gcagcggacgaggtgacagcaggagaagaggctgaggctgaggctgaggctgaggcgacc
accgcagacgacaacagacaagaagaagaagttaaagaggctgaagatggccccgtggag
gagtccaaacccaagcccaggccgttcatgcccaacctggtgccgcccaagatccctgac
ggagagagagtggacttcgacgacatccaccggaagcgcatggagaaggacctgaacgag
ctgcagacgctgatcgaggctcattttgagaaccgcaagaaagaggaagaggagctcatc
tcactcaaggacaggatcgagaagcggcgggcggagcgggccgagcagcagcgcatccgc
agcgagcgggagaaagagcggcaggcccggctggcagaggaacgagcccggcgagaggaa
gaggagagccggaggcgggcagaagacgaggcccggaagaagaaggccctttccaacatg
atgcacttcgggggctacatccagaaggagcagcctcagttctcagcttccagttccagc
tgctccccgggaacccagcagtgcttgtcagccacagaccccccccccacctga

KEGG   Miniopterus natalensis: 107535979
Entry
107535979         CDS       T05883                                 

Definition
(RefSeq) troponin T, cardiac muscle
  KO
K12045  troponin T, cardiac muscle
Organism
mna  Miniopterus natalensis
Pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna05410  Hypertrophic cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107535979
   04261 Adrenergic signaling in cardiomyocytes
    107535979
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107535979
   05414 Dilated cardiomyopathy
    107535979
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107535979
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Troponins
     107535979
SSDB
Motif
Pfam: Troponin
Other DBs
NCBI-GeneID: 107535979
NCBI-ProteinID: XP_016067058
LinkDB
Position
Unknown
AA seq 284 aa
MSDTEEAVEEYEGEQEEQEEAADEVTAGEEAEAEAEAEATTADDNRQEEEVKEAEDGPVE
ESKPKPRPFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQTLIEAHFENRKKEEEELI
SLKDRIEKRRAERAEQQRIRSEREKERQARLAEERARREEEESRRRAEDEARKKKALSNM
MHFGGYIQKTEKRSGKRQTEREKKKKILAERRKVLAIDHLNEDQLREKAKELWQSIYNLE
AEKFDLQEKFKQQKYEINVLRNRINDNQKVSKTRGKAKVTGRWK
NT seq 855 nt   +upstreamnt  +downstreamnt
atgtctgacacagaagaggcggtggaggagtacgagggggagcaggaagagcaggaagag
gcagcggacgaggtgacagcaggagaagaggctgaggctgaggctgaggctgaggcgacc
accgcagacgacaacagacaagaagaagaagttaaagaggctgaagatggccccgtggag
gagtccaaacccaagcccaggccgttcatgcccaacctggtgccgcccaagatccctgac
ggagagagagtggacttcgacgacatccaccggaagcgcatggagaaggacctgaacgag
ctgcagacgctgatcgaggctcattttgagaaccgcaagaaagaggaagaggagctcatc
tcactcaaggacaggatcgagaagcggcgggcggagcgggccgagcagcagcgcatccgc
agcgagcgggagaaagagcggcaggcccggctggcagaggaacgagcccggcgagaggaa
gaggagagccggaggcgggcagaagacgaggcccggaagaagaaggccctttccaacatg
atgcacttcgggggctacatccagaagacggagaagagaagtgggaagaggcagacggag
cgggagaaaaagaagaagattctggccgagaggaggaaggtgctggccatcgaccacctg
aatgaagatcagctgagggagaaagccaaggaactgtggcaaagcatctataacctggag
gccgagaagtttgacctgcaggagaagttcaagcagcagaaatacgagatcaacgttctt
agaaacagaatcaatgacaaccagaaagtctccaagacccgcgggaaggccaaggtcacc
gggcgctggaagtga

DBGET integrated database retrieval system