KEGG   Miniopterus natalensis: 107536004
Entry
107536004         CDS       T05883                                 

Gene name
ADORA1
Definition
(RefSeq) adenosine receptor A1
  KO
K04265  adenosine receptor A1
Organism
mna  Miniopterus natalensis
Pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04071  Sphingolipid signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04923  Regulation of lipolysis in adipocytes
mna04924  Renin secretion
mna05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    107536004 (ADORA1)
   04024 cAMP signaling pathway
    107536004 (ADORA1)
   04022 cGMP-PKG signaling pathway
    107536004 (ADORA1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107536004 (ADORA1)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    107536004 (ADORA1)
   04924 Renin secretion
    107536004 (ADORA1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107536004 (ADORA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107536004 (ADORA1)
G protein-coupled receptors [BR:mna04030]
 Rhodopsin family
  Base and nucleoside
   Adenosine
    107536004 (ADORA1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx UCR_Fe-S_N
Other DBs
NCBI-GeneID: 107536004
NCBI-ProteinID: XP_016067085
LinkDB
Position
Unknown
AA seq 326 aa
MPPSVSAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIASLAVADVAVGA
LVIPLAILINIGPQTHFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT
PRRAAVAIAGCWIVSLVVGLTPMFGWNNLSAVERAWVANGSVGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRRQLNKKVSASAGDPQKYYGKELKIAKSLALIL
LLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPIAGDPPEERPDD
NT seq 981 nt   +upstreamnt  +downstreamnt
atgccgccctctgtctcggccttccaggccgcctacattggcattgaggtgctcatcgcc
ctggtctctgtgcctgggaatgtgctggtgatctgggcagtgaaggtgaaccaggcgctg
cgggatgccaccttctgtttcatcgcatcgctggcagtggctgatgtggccgtgggcgct
ctggtcatcccgcttgccatcctcatcaacattgggccacagacccacttccacacctgc
ctcatggtcgcctgccctgtcctcatcctgacccagagctccatcctggccctgctggcc
attgccgtggaccgctacctccgtgtcaagatcccactccggtacaagacggtggtgacg
ccccggagggctgcggtggccatcgccggctgctggatcgtctcccttgtggtgggcctg
acacccatgttcggctggaataacctgagtgcggtggagcgggcctgggtggccaacggc
agcgtgggcgagccggtgatcaagtgcgagtttgagaaggtcatcagcatggagtacatg
gtctacttcaacttcttcgtgtgggtgctgccccctctgctgctcatggtcctcatctac
ctggaggtcttctacctgatccgcaggcagctcaacaagaaggtgtcggcctccgccggg
gacccacagaagtactacgggaaggagctgaagatcgccaagtcgctggcactcatcctg
ctcctcttcgccctcagctggctgcccctgcacatcctgaactgcatcaccctcttctgc
ccttcctgccacaagcccagcatcctcacctacattgccatcttcctcacgcatggcaac
tcggccatgaaccccattgtctatgcctttcgcatccagaagttccgggtcaccttcctc
aagatttggaatgaccatttccgctgccagcccgcaccccccattgctggggaccccccg
gaagagaggccagatgactaa

DBGET integrated database retrieval system