KEGG   Miniopterus natalensis: 107536041
Entry
107536041         CDS       T05883                                 

Gene name
MAPK12
Definition
(RefSeq) mitogen-activated protein kinase 12
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
mna  Miniopterus natalensis
Pathway
mna01522  Endocrine resistance
mna04010  MAPK signaling pathway
mna04015  Rap1 signaling pathway
mna04068  FoxO signaling pathway
mna04071  Sphingolipid signaling pathway
mna04114  Oocyte meiosis
mna04218  Cellular senescence
mna04261  Adrenergic signaling in cardiomyocytes
mna04370  VEGF signaling pathway
mna04380  Osteoclast differentiation
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04611  Platelet activation
mna04613  Neutrophil extracellular trap formation
mna04620  Toll-like receptor signaling pathway
mna04621  NOD-like receptor signaling pathway
mna04622  RIG-I-like receptor signaling pathway
mna04625  C-type lectin receptor signaling pathway
mna04657  IL-17 signaling pathway
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna04660  T cell receptor signaling pathway
mna04664  Fc epsilon RI signaling pathway
mna04668  TNF signaling pathway
mna04670  Leukocyte transendothelial migration
mna04714  Thermogenesis
mna04722  Neurotrophin signaling pathway
mna04723  Retrograde endocannabinoid signaling
mna04728  Dopaminergic synapse
mna04750  Inflammatory mediator regulation of TRP channels
mna04912  GnRH signaling pathway
mna04914  Progesterone-mediated oocyte maturation
mna04917  Prolactin signaling pathway
mna04926  Relaxin signaling pathway
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna04935  Growth hormone synthesis, secretion and action
mna05014  Amyotrophic lateral sclerosis
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05132  Salmonella infection
mna05133  Pertussis
mna05135  Yersinia infection
mna05140  Leishmaniasis
mna05142  Chagas disease
mna05145  Toxoplasmosis
mna05152  Tuberculosis
mna05161  Hepatitis B
mna05163  Human cytomegalovirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05171  Coronavirus disease - COVID-19
mna05205  Proteoglycans in cancer
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107536041 (MAPK12)
   04015 Rap1 signaling pathway
    107536041 (MAPK12)
   04370 VEGF signaling pathway
    107536041 (MAPK12)
   04668 TNF signaling pathway
    107536041 (MAPK12)
   04068 FoxO signaling pathway
    107536041 (MAPK12)
   04071 Sphingolipid signaling pathway
    107536041 (MAPK12)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107536041 (MAPK12)
   04218 Cellular senescence
    107536041 (MAPK12)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107536041 (MAPK12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107536041 (MAPK12)
   04613 Neutrophil extracellular trap formation
    107536041 (MAPK12)
   04620 Toll-like receptor signaling pathway
    107536041 (MAPK12)
   04621 NOD-like receptor signaling pathway
    107536041 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    107536041 (MAPK12)
   04625 C-type lectin receptor signaling pathway
    107536041 (MAPK12)
   04660 T cell receptor signaling pathway
    107536041 (MAPK12)
   04658 Th1 and Th2 cell differentiation
    107536041 (MAPK12)
   04659 Th17 cell differentiation
    107536041 (MAPK12)
   04657 IL-17 signaling pathway
    107536041 (MAPK12)
   04664 Fc epsilon RI signaling pathway
    107536041 (MAPK12)
   04670 Leukocyte transendothelial migration
    107536041 (MAPK12)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107536041 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    107536041 (MAPK12)
   04917 Prolactin signaling pathway
    107536041 (MAPK12)
   04926 Relaxin signaling pathway
    107536041 (MAPK12)
   04935 Growth hormone synthesis, secretion and action
    107536041 (MAPK12)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107536041 (MAPK12)
  09156 Nervous system
   04728 Dopaminergic synapse
    107536041 (MAPK12)
   04723 Retrograde endocannabinoid signaling
    107536041 (MAPK12)
   04722 Neurotrophin signaling pathway
    107536041 (MAPK12)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107536041 (MAPK12)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107536041 (MAPK12)
  09159 Environmental adaptation
   04714 Thermogenesis
    107536041 (MAPK12)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107536041 (MAPK12)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107536041 (MAPK12)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107536041 (MAPK12)
   05020 Prion disease
    107536041 (MAPK12)
   05022 Pathways of neurodegeneration - multiple diseases
    107536041 (MAPK12)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107536041 (MAPK12)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107536041 (MAPK12)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107536041 (MAPK12)
   05135 Yersinia infection
    107536041 (MAPK12)
   05133 Pertussis
    107536041 (MAPK12)
   05152 Tuberculosis
    107536041 (MAPK12)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107536041 (MAPK12)
   05161 Hepatitis B
    107536041 (MAPK12)
   05171 Coronavirus disease - COVID-19
    107536041 (MAPK12)
   05163 Human cytomegalovirus infection
    107536041 (MAPK12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107536041 (MAPK12)
   05169 Epstein-Barr virus infection
    107536041 (MAPK12)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107536041 (MAPK12)
   05140 Leishmaniasis
    107536041 (MAPK12)
   05142 Chagas disease
    107536041 (MAPK12)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107536041 (MAPK12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107536041 (MAPK12)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107536041 (MAPK12)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107536041 (MAPK12)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kinase-like UvrD_C
Other DBs
NCBI-GeneID: 107536041
NCBI-ProteinID: XP_016067140
LinkDB
Position
Unknown
AA seq 360 aa
MRAQCQLGAGEHGSGGTPGGLAHIEEDLDLDPGPVAESRGALTVGGDGDSCRSLSCLEPS
ASLGGVPPSHLVLLPPPQVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLSE
DRIQFLVYQMLKGLKYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVV
TRWYRAPEVILNWMHYTQTVDIWSAGCIMAEMITGKTLFKGNDHLDQLKEILKVTGTPPD
EFVQRLKSADAKDYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAERRVTAAEALT
HPYFESLQDTEDEPKAQKYDESFDDVDRTLEEWKRDTYKEVLSFRPPRQLGAKASKETSL
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgagggcacagtgccagctgggagctggcgagcatgggagtggggggacaccagggggg
ctggcacacatcgaggaggacttggacttggaccctggacctgtggctgagagccggggt
gctctgacagtggggggagatggggacagctgcaggagcctttcctgcctggagcccagt
gccagcctggggggtgtgcctccatcccacctggtgctcctgcctcctccccaggtgatc
gggctgctggacgtgttcactccggatgagaccctggatgatttcacagacttttacctg
gtcatgccgttcatgggcaccgacctgggcaagctcatgaagcatgagaagctgagtgag
gaccgaattcagttcctcgtctaccagatgctgaaaggactgaagtatatccacgctgct
ggcatcattcacagggacctgaagcccggtaacctggcagtgaatgaggactgtgagctg
aagatcctggactttggcctggccaggcaggcagacagcgagatgactggatatgtagtg
actcggtggtaccgggcacctgaggtcatcttgaattggatgcactacacacagacagtg
gacatctggtctgcgggctgcatcatggctgagatgatcacagggaagacgctgttcaag
ggcaacgaccacctggaccagctgaaggagatcttgaaggtgacaggcacacctcccgat
gaatttgtacagaggctgaagagtgcagatgctaaggactacatgaagggcctccccgag
ttggaaaagaaggattttgcctccatcctgaccaatgcaagccccctggctgtgaacctc
ctggagaaaatgctggtgctggatgcggagcggcgggtgacagccgccgaggctctgacc
cacccgtacttcgagtcactgcaggacacagaggatgagcccaaggcccagaagtatgac
gaatcctttgatgatgtggaccgcacattggaagagtggaagcgtgacacatataaagag
gtgctcagcttcaggcctccccggcagctgggggccaaggcctccaaggagacatccctg
tga

KEGG   Miniopterus natalensis: 107536051
Entry
107536051         CDS       T05883                                 

Gene name
MAPK11
Definition
(RefSeq) mitogen-activated protein kinase 11
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
mna  Miniopterus natalensis
Pathway
mna01522  Endocrine resistance
mna04010  MAPK signaling pathway
mna04015  Rap1 signaling pathway
mna04068  FoxO signaling pathway
mna04071  Sphingolipid signaling pathway
mna04114  Oocyte meiosis
mna04218  Cellular senescence
mna04261  Adrenergic signaling in cardiomyocytes
mna04370  VEGF signaling pathway
mna04380  Osteoclast differentiation
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04611  Platelet activation
mna04613  Neutrophil extracellular trap formation
mna04620  Toll-like receptor signaling pathway
mna04621  NOD-like receptor signaling pathway
mna04622  RIG-I-like receptor signaling pathway
mna04625  C-type lectin receptor signaling pathway
mna04657  IL-17 signaling pathway
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna04660  T cell receptor signaling pathway
mna04664  Fc epsilon RI signaling pathway
mna04668  TNF signaling pathway
mna04670  Leukocyte transendothelial migration
mna04714  Thermogenesis
mna04722  Neurotrophin signaling pathway
mna04723  Retrograde endocannabinoid signaling
mna04728  Dopaminergic synapse
mna04750  Inflammatory mediator regulation of TRP channels
mna04912  GnRH signaling pathway
mna04914  Progesterone-mediated oocyte maturation
mna04917  Prolactin signaling pathway
mna04926  Relaxin signaling pathway
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna04935  Growth hormone synthesis, secretion and action
mna05014  Amyotrophic lateral sclerosis
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05132  Salmonella infection
mna05133  Pertussis
mna05135  Yersinia infection
mna05140  Leishmaniasis
mna05142  Chagas disease
mna05145  Toxoplasmosis
mna05152  Tuberculosis
mna05161  Hepatitis B
mna05163  Human cytomegalovirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05171  Coronavirus disease - COVID-19
mna05205  Proteoglycans in cancer
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107536051 (MAPK11)
   04015 Rap1 signaling pathway
    107536051 (MAPK11)
   04370 VEGF signaling pathway
    107536051 (MAPK11)
   04668 TNF signaling pathway
    107536051 (MAPK11)
   04068 FoxO signaling pathway
    107536051 (MAPK11)
   04071 Sphingolipid signaling pathway
    107536051 (MAPK11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107536051 (MAPK11)
   04218 Cellular senescence
    107536051 (MAPK11)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107536051 (MAPK11)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107536051 (MAPK11)
   04613 Neutrophil extracellular trap formation
    107536051 (MAPK11)
   04620 Toll-like receptor signaling pathway
    107536051 (MAPK11)
   04621 NOD-like receptor signaling pathway
    107536051 (MAPK11)
   04622 RIG-I-like receptor signaling pathway
    107536051 (MAPK11)
   04625 C-type lectin receptor signaling pathway
    107536051 (MAPK11)
   04660 T cell receptor signaling pathway
    107536051 (MAPK11)
   04658 Th1 and Th2 cell differentiation
    107536051 (MAPK11)
   04659 Th17 cell differentiation
    107536051 (MAPK11)
   04657 IL-17 signaling pathway
    107536051 (MAPK11)
   04664 Fc epsilon RI signaling pathway
    107536051 (MAPK11)
   04670 Leukocyte transendothelial migration
    107536051 (MAPK11)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107536051 (MAPK11)
   04914 Progesterone-mediated oocyte maturation
    107536051 (MAPK11)
   04917 Prolactin signaling pathway
    107536051 (MAPK11)
   04926 Relaxin signaling pathway
    107536051 (MAPK11)
   04935 Growth hormone synthesis, secretion and action
    107536051 (MAPK11)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107536051 (MAPK11)
  09156 Nervous system
   04728 Dopaminergic synapse
    107536051 (MAPK11)
   04723 Retrograde endocannabinoid signaling
    107536051 (MAPK11)
   04722 Neurotrophin signaling pathway
    107536051 (MAPK11)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107536051 (MAPK11)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107536051 (MAPK11)
  09159 Environmental adaptation
   04714 Thermogenesis
    107536051 (MAPK11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107536051 (MAPK11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107536051 (MAPK11)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107536051 (MAPK11)
   05020 Prion disease
    107536051 (MAPK11)
   05022 Pathways of neurodegeneration - multiple diseases
    107536051 (MAPK11)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107536051 (MAPK11)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107536051 (MAPK11)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107536051 (MAPK11)
   05135 Yersinia infection
    107536051 (MAPK11)
   05133 Pertussis
    107536051 (MAPK11)
   05152 Tuberculosis
    107536051 (MAPK11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107536051 (MAPK11)
   05161 Hepatitis B
    107536051 (MAPK11)
   05171 Coronavirus disease - COVID-19
    107536051 (MAPK11)
   05163 Human cytomegalovirus infection
    107536051 (MAPK11)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107536051 (MAPK11)
   05169 Epstein-Barr virus infection
    107536051 (MAPK11)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107536051 (MAPK11)
   05140 Leishmaniasis
    107536051 (MAPK11)
   05142 Chagas disease
    107536051 (MAPK11)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107536051 (MAPK11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107536051 (MAPK11)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107536051 (MAPK11)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107536051 (MAPK11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Cas_CT1975 RIO1 Kdo Kinase-like FTA2
Other DBs
NCBI-GeneID: 107536051
NCBI-ProteinID: XP_016067151
LinkDB
Position
Unknown
AA seq 257 aa
MGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILD
FGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTAVDIWSVGCIMAELLQGKALFPGSD
YIDQLKRIMEVVGTPSPEVLEKISSEHARTYIQSLPPMPQKDLRSIFRGANPLAVDLLGR
MLVLDSDQRVSAAEALAHAYFSQYHDPDDEPEAEPYDESVEAKERTLEEWKELTYQEVLS
FKPPEPPQPPGSLDIEQ
NT seq 774 nt   +upstreamnt  +downstreamnt
atgggcgccgacctgaacaacattgtcaagtgccaggcgctgagcgacgagcacgttcag
ttcctcgtgtaccagctgctgcgcgggctgaagtacatccactcggccgggatcatccac
cgggacctgaagcccagcaacgtggctgtgaatgaggactgtgagctcaggatcctggac
tttggactggcacgccaggcagacgaggagatgacaggctacgtggccacgcgctggtac
cgggcccctgagatcatgctcaactggatgcactacaaccagacagcagtggacatctgg
tccgtgggctgcatcatggctgagctgctccaaggaaaggccctcttcccgggcagtgac
tacatcgaccagctgaagcgcatcatggaggtggtgggcacacccagccctgaggttctg
gaaaagatatcctcggaacacgctcggacatacatccagtccctgccccccatgccccag
aaggatctcaggagcatcttccgtggagccaaccccctggctgtggacctcctgggaagg
atgttggtgctggacagtgaccagagggtcagtgcagctgaagccctggctcatgcctac
ttcagccagtaccacgaccccgacgatgagcccgaggccgagccttatgacgaaagcgtt
gaggcaaaggaacgcactctggaggagtggaaggaactcacctaccaggaagtcctcagc
ttcaagcccccagagccaccgcagcctccaggcagcctggacattgagcagtga

KEGG   Miniopterus natalensis: 107545565
Entry
107545565         CDS       T05883                                 

Gene name
MAPK13
Definition
(RefSeq) mitogen-activated protein kinase 13
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
mna  Miniopterus natalensis
Pathway
mna01522  Endocrine resistance
mna04010  MAPK signaling pathway
mna04015  Rap1 signaling pathway
mna04068  FoxO signaling pathway
mna04071  Sphingolipid signaling pathway
mna04114  Oocyte meiosis
mna04218  Cellular senescence
mna04261  Adrenergic signaling in cardiomyocytes
mna04370  VEGF signaling pathway
mna04380  Osteoclast differentiation
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04611  Platelet activation
mna04613  Neutrophil extracellular trap formation
mna04620  Toll-like receptor signaling pathway
mna04621  NOD-like receptor signaling pathway
mna04622  RIG-I-like receptor signaling pathway
mna04625  C-type lectin receptor signaling pathway
mna04657  IL-17 signaling pathway
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna04660  T cell receptor signaling pathway
mna04664  Fc epsilon RI signaling pathway
mna04668  TNF signaling pathway
mna04670  Leukocyte transendothelial migration
mna04714  Thermogenesis
mna04722  Neurotrophin signaling pathway
mna04723  Retrograde endocannabinoid signaling
mna04728  Dopaminergic synapse
mna04750  Inflammatory mediator regulation of TRP channels
mna04912  GnRH signaling pathway
mna04914  Progesterone-mediated oocyte maturation
mna04917  Prolactin signaling pathway
mna04926  Relaxin signaling pathway
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna04935  Growth hormone synthesis, secretion and action
mna05014  Amyotrophic lateral sclerosis
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05132  Salmonella infection
mna05133  Pertussis
mna05135  Yersinia infection
mna05140  Leishmaniasis
mna05142  Chagas disease
mna05145  Toxoplasmosis
mna05152  Tuberculosis
mna05161  Hepatitis B
mna05163  Human cytomegalovirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05171  Coronavirus disease - COVID-19
mna05205  Proteoglycans in cancer
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107545565 (MAPK13)
   04015 Rap1 signaling pathway
    107545565 (MAPK13)
   04370 VEGF signaling pathway
    107545565 (MAPK13)
   04668 TNF signaling pathway
    107545565 (MAPK13)
   04068 FoxO signaling pathway
    107545565 (MAPK13)
   04071 Sphingolipid signaling pathway
    107545565 (MAPK13)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107545565 (MAPK13)
   04218 Cellular senescence
    107545565 (MAPK13)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107545565 (MAPK13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107545565 (MAPK13)
   04613 Neutrophil extracellular trap formation
    107545565 (MAPK13)
   04620 Toll-like receptor signaling pathway
    107545565 (MAPK13)
   04621 NOD-like receptor signaling pathway
    107545565 (MAPK13)
   04622 RIG-I-like receptor signaling pathway
    107545565 (MAPK13)
   04625 C-type lectin receptor signaling pathway
    107545565 (MAPK13)
   04660 T cell receptor signaling pathway
    107545565 (MAPK13)
   04658 Th1 and Th2 cell differentiation
    107545565 (MAPK13)
   04659 Th17 cell differentiation
    107545565 (MAPK13)
   04657 IL-17 signaling pathway
    107545565 (MAPK13)
   04664 Fc epsilon RI signaling pathway
    107545565 (MAPK13)
   04670 Leukocyte transendothelial migration
    107545565 (MAPK13)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107545565 (MAPK13)
   04914 Progesterone-mediated oocyte maturation
    107545565 (MAPK13)
   04917 Prolactin signaling pathway
    107545565 (MAPK13)
   04926 Relaxin signaling pathway
    107545565 (MAPK13)
   04935 Growth hormone synthesis, secretion and action
    107545565 (MAPK13)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107545565 (MAPK13)
  09156 Nervous system
   04728 Dopaminergic synapse
    107545565 (MAPK13)
   04723 Retrograde endocannabinoid signaling
    107545565 (MAPK13)
   04722 Neurotrophin signaling pathway
    107545565 (MAPK13)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107545565 (MAPK13)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107545565 (MAPK13)
  09159 Environmental adaptation
   04714 Thermogenesis
    107545565 (MAPK13)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107545565 (MAPK13)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107545565 (MAPK13)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107545565 (MAPK13)
   05020 Prion disease
    107545565 (MAPK13)
   05022 Pathways of neurodegeneration - multiple diseases
    107545565 (MAPK13)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107545565 (MAPK13)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107545565 (MAPK13)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107545565 (MAPK13)
   05135 Yersinia infection
    107545565 (MAPK13)
   05133 Pertussis
    107545565 (MAPK13)
   05152 Tuberculosis
    107545565 (MAPK13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107545565 (MAPK13)
   05161 Hepatitis B
    107545565 (MAPK13)
   05171 Coronavirus disease - COVID-19
    107545565 (MAPK13)
   05163 Human cytomegalovirus infection
    107545565 (MAPK13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107545565 (MAPK13)
   05169 Epstein-Barr virus infection
    107545565 (MAPK13)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107545565 (MAPK13)
   05140 Leishmaniasis
    107545565 (MAPK13)
   05142 Chagas disease
    107545565 (MAPK13)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107545565 (MAPK13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107545565 (MAPK13)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107545565 (MAPK13)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107545565 (MAPK13)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH RIO1 Kinase-like Kdo DUF4023
Other DBs
NCBI-GeneID: 107545565
NCBI-ProteinID: XP_016079156
LinkDB
Position
Unknown
AA seq 353 aa
MEGVEQANRVTLFLLFGRSLDLGLLQTPSSAIDKRSGEKVAIKKLSRPFQSEIFARRAYR
ELLLLKHMQHENVIGLLDVFTPASSLRSFHDFYLVMPFMQTDLQKIMGMEFSEDKIQYLV
YQMLKGLKYIHSAGVIHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAP
EVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGAEFVQKLN
DKAAKAYIQSLPQSPKKDFSQLFPRASPQAVDLLEKILELDVDKRLTASQALAHPFFEPF
RDPEEETEAQKFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggaaggggtggagcaggccaaccgagtgaccctgttcctgctgtttggcaggtcattg
gatctgggactgctccagacaccaagctccgccatcgacaagcggtcgggagagaaggtg
gccatcaagaagctgagccggcccttccagtcggagatcttcgccaggagggcctaccgg
gagctgctgctgctgaagcacatgcagcacgagaacgtcatcgggctcctggatgtcttc
accccagcctcctccctgcgcagcttccatgacttctacctggtgatgcccttcatgcag
acggacctgcagaagatcatgggcatggagttcagtgaggacaagatccagtacctggtg
tatcagatgctcaagggtcttaagtatatccactcggctggcgtcatccacagggacctg
aagccgggcaacctcgccgtgaacgaggactgtgagctgaagatcttggattttgggctg
gcacggcatgcggacgccgagatgactggctacgtggtgacccgctggtatcgggccccc
gaggtgatcctcagctggatgcactacaaccagactgtggacatctggtccgtgggctgc
atcatggctgagatgctgacggggaagacgctgttcaaggggaaagattacctggaccag
ctgacccagatcctgaaggtgaccggggtgccaggtgcagagtttgtgcagaagctgaat
gacaaagcggccaaagcctatatccagtccctgccacagagccccaagaaggacttctct
cagctcttcccccgcgccagcccccaggccgtggacctgctggagaagattctggagctg
gacgtggacaagcgcctgacggcctcgcaggccctggcccaccccttctttgaacccttc
cgggaccctgaggaggagacagaggcccagaaatttgacgattccttagaacatgagaaa
ctcacagtggacgaatggaagcagcacatctacaaggagattgtgaacttcagccccatt
gcccggaaggactcacgacgccggagtggcatgaagctgtga

KEGG   Miniopterus natalensis: 107545613
Entry
107545613         CDS       T05883                                 

Gene name
MAPK14
Definition
(RefSeq) mitogen-activated protein kinase 14 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
mna  Miniopterus natalensis
Pathway
mna01522  Endocrine resistance
mna04010  MAPK signaling pathway
mna04015  Rap1 signaling pathway
mna04068  FoxO signaling pathway
mna04071  Sphingolipid signaling pathway
mna04114  Oocyte meiosis
mna04218  Cellular senescence
mna04261  Adrenergic signaling in cardiomyocytes
mna04370  VEGF signaling pathway
mna04380  Osteoclast differentiation
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04611  Platelet activation
mna04613  Neutrophil extracellular trap formation
mna04620  Toll-like receptor signaling pathway
mna04621  NOD-like receptor signaling pathway
mna04622  RIG-I-like receptor signaling pathway
mna04625  C-type lectin receptor signaling pathway
mna04657  IL-17 signaling pathway
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna04660  T cell receptor signaling pathway
mna04664  Fc epsilon RI signaling pathway
mna04668  TNF signaling pathway
mna04670  Leukocyte transendothelial migration
mna04714  Thermogenesis
mna04722  Neurotrophin signaling pathway
mna04723  Retrograde endocannabinoid signaling
mna04728  Dopaminergic synapse
mna04750  Inflammatory mediator regulation of TRP channels
mna04912  GnRH signaling pathway
mna04914  Progesterone-mediated oocyte maturation
mna04917  Prolactin signaling pathway
mna04926  Relaxin signaling pathway
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna04935  Growth hormone synthesis, secretion and action
mna05014  Amyotrophic lateral sclerosis
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05132  Salmonella infection
mna05133  Pertussis
mna05135  Yersinia infection
mna05140  Leishmaniasis
mna05142  Chagas disease
mna05145  Toxoplasmosis
mna05152  Tuberculosis
mna05161  Hepatitis B
mna05163  Human cytomegalovirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05171  Coronavirus disease - COVID-19
mna05205  Proteoglycans in cancer
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107545613 (MAPK14)
   04015 Rap1 signaling pathway
    107545613 (MAPK14)
   04370 VEGF signaling pathway
    107545613 (MAPK14)
   04668 TNF signaling pathway
    107545613 (MAPK14)
   04068 FoxO signaling pathway
    107545613 (MAPK14)
   04071 Sphingolipid signaling pathway
    107545613 (MAPK14)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107545613 (MAPK14)
   04218 Cellular senescence
    107545613 (MAPK14)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107545613 (MAPK14)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107545613 (MAPK14)
   04613 Neutrophil extracellular trap formation
    107545613 (MAPK14)
   04620 Toll-like receptor signaling pathway
    107545613 (MAPK14)
   04621 NOD-like receptor signaling pathway
    107545613 (MAPK14)
   04622 RIG-I-like receptor signaling pathway
    107545613 (MAPK14)
   04625 C-type lectin receptor signaling pathway
    107545613 (MAPK14)
   04660 T cell receptor signaling pathway
    107545613 (MAPK14)
   04658 Th1 and Th2 cell differentiation
    107545613 (MAPK14)
   04659 Th17 cell differentiation
    107545613 (MAPK14)
   04657 IL-17 signaling pathway
    107545613 (MAPK14)
   04664 Fc epsilon RI signaling pathway
    107545613 (MAPK14)
   04670 Leukocyte transendothelial migration
    107545613 (MAPK14)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107545613 (MAPK14)
   04914 Progesterone-mediated oocyte maturation
    107545613 (MAPK14)
   04917 Prolactin signaling pathway
    107545613 (MAPK14)
   04926 Relaxin signaling pathway
    107545613 (MAPK14)
   04935 Growth hormone synthesis, secretion and action
    107545613 (MAPK14)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107545613 (MAPK14)
  09156 Nervous system
   04728 Dopaminergic synapse
    107545613 (MAPK14)
   04723 Retrograde endocannabinoid signaling
    107545613 (MAPK14)
   04722 Neurotrophin signaling pathway
    107545613 (MAPK14)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107545613 (MAPK14)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107545613 (MAPK14)
  09159 Environmental adaptation
   04714 Thermogenesis
    107545613 (MAPK14)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107545613 (MAPK14)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107545613 (MAPK14)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107545613 (MAPK14)
   05020 Prion disease
    107545613 (MAPK14)
   05022 Pathways of neurodegeneration - multiple diseases
    107545613 (MAPK14)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107545613 (MAPK14)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107545613 (MAPK14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107545613 (MAPK14)
   05135 Yersinia infection
    107545613 (MAPK14)
   05133 Pertussis
    107545613 (MAPK14)
   05152 Tuberculosis
    107545613 (MAPK14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107545613 (MAPK14)
   05161 Hepatitis B
    107545613 (MAPK14)
   05171 Coronavirus disease - COVID-19
    107545613 (MAPK14)
   05163 Human cytomegalovirus infection
    107545613 (MAPK14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107545613 (MAPK14)
   05169 Epstein-Barr virus infection
    107545613 (MAPK14)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107545613 (MAPK14)
   05140 Leishmaniasis
    107545613 (MAPK14)
   05142 Chagas disease
    107545613 (MAPK14)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107545613 (MAPK14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107545613 (MAPK14)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107545613 (MAPK14)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107545613 (MAPK14)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH NAD_binding_8 Kinase-like
Other DBs
NCBI-GeneID: 107545613
NCBI-ProteinID: XP_016079210
LinkDB
Position
Unknown
AA seq 360 aa
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHGYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgtctcaggaaaggcccacgttctaccggcaggagctgaacaagactatctgggaggtg
cccgagcggtaccagaacctgtccccggtgggctccggcgcctatggctccgtgtgtgct
gcttttgacacgaagaccggtttgcgtgtggcggtgaagaagctctccaggccgtttcag
tccatcatccacgccaagaggacctaccgagagctgcggctgctcaagcatatgaaacat
gaaaacgtgattggtctgttggacgtttttacacctgcaaggtccttggaggaattcaat
gatgtgtatctggtgacccatctcatgggggcagatctgaacaacattgtgaaatgccag
aagctgacggatgaccatgttcagttccttatctaccagattctccgaggtctcaagtat
atacattcagccgacataattcacagggacctgaaacctagcaatctagccgtgaatgaa
gactgtgagctgaagatcttggatttcggactggctcggcacacagacgatgagatgaca
ggctatgtggccaccaggtggtacagggctcccgagatcatgctgaactggatgcattac
aaccagacagttgatatttggtcggtgggatgcataatggccgagctgctgactggaaga
acattgtttcctggtacagaccatattgatcagttgaagctcattttaagactcgttgga
accccaggggctgagcttttgaagaaaatctcctcagagtctgcaagaaactacatccag
tctttgacccagatgccgaagatgaactttgccaatgtatttattggtgccaatcccttg
gctgtcgacttgctggagaagatgcttgtactggactcggacaagagaatcacagcagcc
caagcgctcgcacatggctactttgctcagtaccatgatcctgacgatgagccggtggcc
gacccttatgaccagtccttcgagagcagggacctccttatagacgagtggaaaagcctg
acctacgatgaagttatcagcttcgtgcctccaccccttgaccaagaagagatggaatcc
tga

DBGET integrated database retrieval system