KEGG   Miniopterus natalensis: 107536108
Entry
107536108         CDS       T05883                                 

Gene name
PPP3CC
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04114  Oocyte meiosis
mna04218  Cellular senescence
mna04310  Wnt signaling pathway
mna04360  Axon guidance
mna04370  VEGF signaling pathway
mna04380  Osteoclast differentiation
mna04625  C-type lectin receptor signaling pathway
mna04650  Natural killer cell mediated cytotoxicity
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna04660  T cell receptor signaling pathway
mna04662  B cell receptor signaling pathway
mna04720  Long-term potentiation
mna04724  Glutamatergic synapse
mna04728  Dopaminergic synapse
mna04921  Oxytocin signaling pathway
mna04922  Glucagon signaling pathway
mna04924  Renin secretion
mna05010  Alzheimer disease
mna05014  Amyotrophic lateral sclerosis
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05031  Amphetamine addiction
mna05152  Tuberculosis
mna05163  Human cytomegalovirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107536108 (PPP3CC)
   04310 Wnt signaling pathway
    107536108 (PPP3CC)
   04370 VEGF signaling pathway
    107536108 (PPP3CC)
   04020 Calcium signaling pathway
    107536108 (PPP3CC)
   04022 cGMP-PKG signaling pathway
    107536108 (PPP3CC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107536108 (PPP3CC)
   04218 Cellular senescence
    107536108 (PPP3CC)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107536108 (PPP3CC)
   04650 Natural killer cell mediated cytotoxicity
    107536108 (PPP3CC)
   04660 T cell receptor signaling pathway
    107536108 (PPP3CC)
   04658 Th1 and Th2 cell differentiation
    107536108 (PPP3CC)
   04659 Th17 cell differentiation
    107536108 (PPP3CC)
   04662 B cell receptor signaling pathway
    107536108 (PPP3CC)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    107536108 (PPP3CC)
   04921 Oxytocin signaling pathway
    107536108 (PPP3CC)
   04924 Renin secretion
    107536108 (PPP3CC)
  09156 Nervous system
   04724 Glutamatergic synapse
    107536108 (PPP3CC)
   04728 Dopaminergic synapse
    107536108 (PPP3CC)
   04720 Long-term potentiation
    107536108 (PPP3CC)
  09158 Development and regeneration
   04360 Axon guidance
    107536108 (PPP3CC)
   04380 Osteoclast differentiation
    107536108 (PPP3CC)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107536108 (PPP3CC)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107536108 (PPP3CC)
   05014 Amyotrophic lateral sclerosis
    107536108 (PPP3CC)
   05020 Prion disease
    107536108 (PPP3CC)
   05022 Pathways of neurodegeneration - multiple diseases
    107536108 (PPP3CC)
  09165 Substance dependence
   05031 Amphetamine addiction
    107536108 (PPP3CC)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107536108 (PPP3CC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107536108 (PPP3CC)
   05170 Human immunodeficiency virus 1 infection
    107536108 (PPP3CC)
   05163 Human cytomegalovirus infection
    107536108 (PPP3CC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107536108 (PPP3CC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107536108 (PPP3CC)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107536108 (PPP3CC)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     107536108 (PPP3CC)
SSDB
Motif
Pfam: Metallophos DUF5378 PTEN_C2
Other DBs
NCBI-GeneID: 107536108
NCBI-ProteinID: XP_016067223
LinkDB
Position
Unknown
AA seq 522 aa
MSGSNFHLSTTERVVKAVPFPPTQRLTLKEVFENGKPKIDVLKNHLVKEGRLEEEVALKI
INDGAAILRQEKTMIEVDAPITVCGDIHGQFFDLMKLFEVGGSPNNTRYLFLGDYVDRGY
FSIECVLFLWSLKINHPKTLFLLRGNHECRHLTEYFTFKQECRIKYSEQVYDACMNTFDC
LPLAALLNQQFLCVHGGMSPEITCLNDIRKLDRFKEPPAFGPVCDLLWSDPSEDYGNEKT
LEHYTHNTVRGCSYFYSYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLIT
IFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEM
LVNILNICSDDELISDDEIEGGTTVRKEIIKNKIRAIGKMARVFSILRQESESVLTLKGL
TPTGTLPLGVLSGGKQTIETATVEAVEAREAIRGFSLQHRIRSFEEARGLDRINERMPPR
KDGQYSDGPGKFVTPVQPNAAHRSEKGKKASNDSCGTGGSKT
NT seq 1569 nt   +upstreamnt  +downstreamnt
atgtccgggagtaacttccacctctccaccaccgaacgcgtcgtcaaagctgtccccttc
cctccaacccaacggcttactttgaaggaagtctttgaaaatgggaaacctaaaattgat
gtcttgaaaaaccatttggtgaaggaagggcgactggaagaggaagtagccttaaagatt
atcaatgatggggctgccatcctgagacaagagaagactatgatagaagtagatgctcca
attacggtgtgtggtgacattcacggacaattctttgacctgatgaagttgtttgaagtt
ggaggatcacctaataacacacgctacctctttctgggtgactatgttgacagaggctat
ttcagtatagagtgtgtactatttttatggagtttaaagattaatcatcccaaaacattg
tttctgcttcggggaaatcatgaatgcaggcatcttacagaatatttcaccttcaaacag
gaatgtcgaatcaagtattctgaacaggtgtatgatgcatgtatgaatacatttgactgt
cttccccttgctgccctcttaaatcagcagtttctgtgtgtacatggagggatgtcacct
gaaattacttgtttaaatgacattaggaaattagacaggtttaaagaacctccagccttt
gggccagtgtgtgacctcctttggtctgatccctcagaggactatggcaatgaaaagacc
ttggagcactatacccacaacactgtccgagggtgctcttatttttacagttaccctgca
gtttgtgaatttttgcagaataataatttgttatcaataatcagagcccatgaagcccaa
gatgctgggtatcgaatgtacaggaagagccaaacaacaggctttccatcactcattaca
attttctctgcccccaattacctagatgtctataacaataaagctgctgtgttaaaatat
gaaaacaatgtcatgaatatcaggcagtttaactgttctccacacccctactggcttcca
aattttatggatgttttcacgtggtctttgccttttgttggggaaaaagtcacagagatg
ctggttaacattctcaacatatgctctgatgatgagttgatttccgatgatgaaattgaa
ggaggcactacggttcgaaaggagatcatcaagaataaaatcagagccattgggaagatg
gcacgggtcttttcaattcttcggcaagaaagtgagagtgtgctgactctcaagggcctg
actcctacaggtacactccctctgggtgtcctctcaggaggaaagcagactattgagaca
gccacagtagaagcggtagaggcccgggaagctatcagagggttttcacttcagcacagg
atccggagttttgaagaagccagaggtctagaccgaattaatgagcggatgccaccccga
aaagatggccagtactccgatgggccagggaaattcgtaacccctgtacaaccaaatgct
gcacacaggagtgagaaggggaaaaaagccagtaatgactcctgtggcacaggtggatct
aaaacttag

KEGG   Miniopterus natalensis: 107545505
Entry
107545505         CDS       T05883                                 

Gene name
PPP3CA
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04114  Oocyte meiosis
mna04218  Cellular senescence
mna04310  Wnt signaling pathway
mna04360  Axon guidance
mna04370  VEGF signaling pathway
mna04380  Osteoclast differentiation
mna04625  C-type lectin receptor signaling pathway
mna04650  Natural killer cell mediated cytotoxicity
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna04660  T cell receptor signaling pathway
mna04662  B cell receptor signaling pathway
mna04720  Long-term potentiation
mna04724  Glutamatergic synapse
mna04728  Dopaminergic synapse
mna04921  Oxytocin signaling pathway
mna04922  Glucagon signaling pathway
mna04924  Renin secretion
mna05010  Alzheimer disease
mna05014  Amyotrophic lateral sclerosis
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05031  Amphetamine addiction
mna05152  Tuberculosis
mna05163  Human cytomegalovirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107545505 (PPP3CA)
   04310 Wnt signaling pathway
    107545505 (PPP3CA)
   04370 VEGF signaling pathway
    107545505 (PPP3CA)
   04020 Calcium signaling pathway
    107545505 (PPP3CA)
   04022 cGMP-PKG signaling pathway
    107545505 (PPP3CA)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107545505 (PPP3CA)
   04218 Cellular senescence
    107545505 (PPP3CA)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107545505 (PPP3CA)
   04650 Natural killer cell mediated cytotoxicity
    107545505 (PPP3CA)
   04660 T cell receptor signaling pathway
    107545505 (PPP3CA)
   04658 Th1 and Th2 cell differentiation
    107545505 (PPP3CA)
   04659 Th17 cell differentiation
    107545505 (PPP3CA)
   04662 B cell receptor signaling pathway
    107545505 (PPP3CA)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    107545505 (PPP3CA)
   04921 Oxytocin signaling pathway
    107545505 (PPP3CA)
   04924 Renin secretion
    107545505 (PPP3CA)
  09156 Nervous system
   04724 Glutamatergic synapse
    107545505 (PPP3CA)
   04728 Dopaminergic synapse
    107545505 (PPP3CA)
   04720 Long-term potentiation
    107545505 (PPP3CA)
  09158 Development and regeneration
   04360 Axon guidance
    107545505 (PPP3CA)
   04380 Osteoclast differentiation
    107545505 (PPP3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107545505 (PPP3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107545505 (PPP3CA)
   05014 Amyotrophic lateral sclerosis
    107545505 (PPP3CA)
   05020 Prion disease
    107545505 (PPP3CA)
   05022 Pathways of neurodegeneration - multiple diseases
    107545505 (PPP3CA)
  09165 Substance dependence
   05031 Amphetamine addiction
    107545505 (PPP3CA)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107545505 (PPP3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107545505 (PPP3CA)
   05170 Human immunodeficiency virus 1 infection
    107545505 (PPP3CA)
   05163 Human cytomegalovirus infection
    107545505 (PPP3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107545505 (PPP3CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107545505 (PPP3CA)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107545505 (PPP3CA)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     107545505 (PPP3CA)
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 107545505
NCBI-ProteinID: XP_016079080
LinkDB
Position
Unknown
AA seq 511 aa
MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESV
ALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYV
DRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMD
AFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFG
NEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFP
SLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEK
VTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESV
LTLKGLTPTGMLPSGVLSGGKQTLQSAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAM
PSDANLNSINKALASETNGTDSNGSNSSNIQ
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgtccgagcccaaggcaattgatcccaagttgtcgacgaccgacagggtggtgaaagct
gtcccatttcctccaagccaccggcttacagcaaaagaagtctttgataacgatgggaaa
cctcgtgtggatatcttaaaggcacatctcatgaaggagggcaggctggaagagagtgtt
gcattgagaataataacagagggggcttcaattcttcgacaggaaaaaaatttgctggat
atcgatgcaccagtcacagtttgtggggacatccatggacaattctttgacttgatgaag
ctcttcgaagtggggggatctcctgccaacactcgctacctcttcttaggggactatgtt
gacagagggtacttcagtatcgaatgtgtgctgtacttgtgggccttgaaaattctctac
cccaaaacactgtttttactccgtggaaatcatgaatgtagacatctaacagagtatttc
acatttaaacaagaatgtaaaataaagtattcagaacgcgtctatgatgcttgtatggac
gcctttgactgcctgcccctggctgccttgatgaaccagcagttcctgtgtgtacatggc
ggtctgtctccagagatcaacactttagacgatatcagaaaattagaccgattcaaagaa
ccacctgcttatggacctatgtgcgacatcctgtggtcagaccccctggaggactttggc
aatgagaagactcaggaacatttcactcacaacacagtcagggggtgttcgtacttctac
agttacccggctgtttgtgaattcttacagcacaataacttgttatctatactccgagcc
catgaagcccaggatgcagggtatcgcatgtacaggaaaagccagacaacaggcttccct
tctctaattacgattttctcagcaccaaattacttagatgtatacaataacaaagctgca
gtattgaagtacgagaacaacgtcatgaatatcaggcaattcaactgttctcctcatcca
tactggcttccaaatttcatggatgttttcacttggtctctgccatttgttggggaaaaa
gtcactgagatgctggtaaatgtcctcaacatctgctcagatgacgaactagggtcggaa
gaagatggatttgatggagccacggccgcggcccggaaggaggtgatcagaaacaagatc
cgagccataggcaaaatggccagagtgttctcggtcctcagagaagagagcgagagcgtg
ctgacgctgaaaggcctgacgcccaccggcatgctccccagcggcgtgctctcgggaggc
aagcagacgctgcagagcgctatcaagggattctcaccacaacataagatcactagcttc
gaggaggccaagggcttggaccgaattaacgagaggatgccgcctcgcagagatgccatg
ccctccgacgccaacctcaactccatcaacaaggcgctcgcctcggagactaacggcacg
gacagcaatggcagtaatagcagcaatatccagtga

KEGG   Miniopterus natalensis: 107545813
Entry
107545813         CDS       T05883                                 

Gene name
PPP3CB
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit beta isoform isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04114  Oocyte meiosis
mna04218  Cellular senescence
mna04310  Wnt signaling pathway
mna04360  Axon guidance
mna04370  VEGF signaling pathway
mna04380  Osteoclast differentiation
mna04625  C-type lectin receptor signaling pathway
mna04650  Natural killer cell mediated cytotoxicity
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna04660  T cell receptor signaling pathway
mna04662  B cell receptor signaling pathway
mna04720  Long-term potentiation
mna04724  Glutamatergic synapse
mna04728  Dopaminergic synapse
mna04921  Oxytocin signaling pathway
mna04922  Glucagon signaling pathway
mna04924  Renin secretion
mna05010  Alzheimer disease
mna05014  Amyotrophic lateral sclerosis
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05031  Amphetamine addiction
mna05152  Tuberculosis
mna05163  Human cytomegalovirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107545813 (PPP3CB)
   04310 Wnt signaling pathway
    107545813 (PPP3CB)
   04370 VEGF signaling pathway
    107545813 (PPP3CB)
   04020 Calcium signaling pathway
    107545813 (PPP3CB)
   04022 cGMP-PKG signaling pathway
    107545813 (PPP3CB)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107545813 (PPP3CB)
   04218 Cellular senescence
    107545813 (PPP3CB)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107545813 (PPP3CB)
   04650 Natural killer cell mediated cytotoxicity
    107545813 (PPP3CB)
   04660 T cell receptor signaling pathway
    107545813 (PPP3CB)
   04658 Th1 and Th2 cell differentiation
    107545813 (PPP3CB)
   04659 Th17 cell differentiation
    107545813 (PPP3CB)
   04662 B cell receptor signaling pathway
    107545813 (PPP3CB)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    107545813 (PPP3CB)
   04921 Oxytocin signaling pathway
    107545813 (PPP3CB)
   04924 Renin secretion
    107545813 (PPP3CB)
  09156 Nervous system
   04724 Glutamatergic synapse
    107545813 (PPP3CB)
   04728 Dopaminergic synapse
    107545813 (PPP3CB)
   04720 Long-term potentiation
    107545813 (PPP3CB)
  09158 Development and regeneration
   04360 Axon guidance
    107545813 (PPP3CB)
   04380 Osteoclast differentiation
    107545813 (PPP3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107545813 (PPP3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107545813 (PPP3CB)
   05014 Amyotrophic lateral sclerosis
    107545813 (PPP3CB)
   05020 Prion disease
    107545813 (PPP3CB)
   05022 Pathways of neurodegeneration - multiple diseases
    107545813 (PPP3CB)
  09165 Substance dependence
   05031 Amphetamine addiction
    107545813 (PPP3CB)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107545813 (PPP3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107545813 (PPP3CB)
   05170 Human immunodeficiency virus 1 infection
    107545813 (PPP3CB)
   05163 Human cytomegalovirus infection
    107545813 (PPP3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107545813 (PPP3CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107545813 (PPP3CB)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107545813 (PPP3CB)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     107545813 (PPP3CB)
SSDB
Motif
Pfam: Metallophos DUF5378
Other DBs
NCBI-GeneID: 107545813
NCBI-ProteinID: XP_016079526
LinkDB
Position
Unknown
AA seq 480 aa
MDGIPRVDVLKNHLVKEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFF
DLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECRHL
TEYFTFKQECKIKYSERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLD
RFKEPPAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLS
IIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNC
SPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDVGSAAARKEI
IRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAE
KAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQPDGFNSLNTAHATENHGTGNHSAQ
NT seq 1443 nt   +upstreamnt  +downstreamnt
atggatgggatacccagggttgatgttctgaagaaccacttagtaaaagaaggtcgggta
gatgaagaaattgcacttagaattatcaatgagggtgctgccatccttcggagagagaaa
accatgatagaagtagaggctccaattacagtgtgtggtgacatccatggccaatttttt
gatctgatgaaactttttgaagtaggaggatcacctgctaatacacgatacctttttctt
ggtgattatgtggacagaggttattttagtatagagtgtgtcttatatttatgggtcctg
aagattctgtacccaagcacattatttcttctgagaggcaatcatgaatgcagacacctt
actgagtattttacctttaagcaggaatgtaaaattaaatattcagaaagagtctatgaa
gcttgtatggaagcttttgatagtctccctcttgctgcacttttaaaccaacaatttctt
tgtgttcatggtggactttcaccagaaatccacacactggatgatattaggagattagat
agattcaaagagccacctgcatttggaccaatgtgtgacttgttatggtccgatccttct
gaagattttggaaatgaaaaatcacaggaacattttagtcacaatacagttcgaggatgt
tcttatttttataactatccagcagtgtgtgaatttttgcaaaacaataatttgttatcg
attattagagctcatgaagctcaagatgcaggctatagaatgtacagaaaaagtcaaact
acagggttcccttcattaataacaattttttcggcacctaattacttagatgtctacaat
aataaagctgctgtattaaagtatgaaaataatgtgatgaatattcgacagtttaactgt
tctccacatccttactggttgcccaattttatggatgtcttcacatggtctttaccattt
gttggagaaaaagtgacagaaatgttggtaaatgttctgagtatttgctctgatgatgaa
ctgatgactgaaggtgaagaccagtttgatgtaggttcagctgcagcccggaaagaaatc
ataagaaacaaaattcgagcaattggcaagatggcaagggtcttctctgttctcagggag
gagagtgaaagtgtgctgacactcaagggtctgactcccacagggatgttgcctagtgga
gtgttggctggaggacgacagaccctgcaaagtgccacagttgaggctattgaggctgaa
aaagcaatacgaggattctctccaccacatagaatctgcagttttgaagaggcaaagggt
ttggataggatcaatgagagaatgccaccccggaaagatgctgtacagccagatggtttc
aattctctgaacaccgcacatgccactgagaaccacgggactggcaaccatagtgcccag
tga

KEGG   Miniopterus natalensis: 107545969
Entry
107545969         CDS       T05883                                 

Gene name
PPP3R1
Definition
(RefSeq) calcineurin subunit B type 1
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04114  Oocyte meiosis
mna04218  Cellular senescence
mna04310  Wnt signaling pathway
mna04360  Axon guidance
mna04370  VEGF signaling pathway
mna04380  Osteoclast differentiation
mna04625  C-type lectin receptor signaling pathway
mna04650  Natural killer cell mediated cytotoxicity
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna04660  T cell receptor signaling pathway
mna04662  B cell receptor signaling pathway
mna04720  Long-term potentiation
mna04724  Glutamatergic synapse
mna04921  Oxytocin signaling pathway
mna04922  Glucagon signaling pathway
mna04924  Renin secretion
mna05010  Alzheimer disease
mna05014  Amyotrophic lateral sclerosis
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05031  Amphetamine addiction
mna05152  Tuberculosis
mna05163  Human cytomegalovirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107545969 (PPP3R1)
   04310 Wnt signaling pathway
    107545969 (PPP3R1)
   04370 VEGF signaling pathway
    107545969 (PPP3R1)
   04020 Calcium signaling pathway
    107545969 (PPP3R1)
   04022 cGMP-PKG signaling pathway
    107545969 (PPP3R1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107545969 (PPP3R1)
   04218 Cellular senescence
    107545969 (PPP3R1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107545969 (PPP3R1)
   04650 Natural killer cell mediated cytotoxicity
    107545969 (PPP3R1)
   04660 T cell receptor signaling pathway
    107545969 (PPP3R1)
   04658 Th1 and Th2 cell differentiation
    107545969 (PPP3R1)
   04659 Th17 cell differentiation
    107545969 (PPP3R1)
   04662 B cell receptor signaling pathway
    107545969 (PPP3R1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    107545969 (PPP3R1)
   04921 Oxytocin signaling pathway
    107545969 (PPP3R1)
   04924 Renin secretion
    107545969 (PPP3R1)
  09156 Nervous system
   04724 Glutamatergic synapse
    107545969 (PPP3R1)
   04720 Long-term potentiation
    107545969 (PPP3R1)
  09158 Development and regeneration
   04360 Axon guidance
    107545969 (PPP3R1)
   04380 Osteoclast differentiation
    107545969 (PPP3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107545969 (PPP3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107545969 (PPP3R1)
   05014 Amyotrophic lateral sclerosis
    107545969 (PPP3R1)
   05020 Prion disease
    107545969 (PPP3R1)
   05022 Pathways of neurodegeneration - multiple diseases
    107545969 (PPP3R1)
  09165 Substance dependence
   05031 Amphetamine addiction
    107545969 (PPP3R1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107545969 (PPP3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107545969 (PPP3R1)
   05170 Human immunodeficiency virus 1 infection
    107545969 (PPP3R1)
   05163 Human cytomegalovirus infection
    107545969 (PPP3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107545969 (PPP3R1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107545969 (PPP3R1)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     107545969 (PPP3R1)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 107545969
NCBI-ProteinID: XP_016079690
LinkDB
Position
Unknown
AA seq 160 aa
MCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEV
DFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQ
QIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 483 nt   +upstreamnt  +downstreamnt
atgtgctcacactttgatgctgatgaaattaaaaggctaggaaagagatttaagaagctt
gatttggacaattctggttctttgagtgtggaagagttcatgtctctgccggagttacaa
cagaatcctttagtacagcgagtaatagatatattcgacacagatgggaacggagaagta
gactttaaagaattcattgagggagtctctcagttcagtgtcaaaggcgataaggagcag
aagttgaggtttgctttccgaatctatgacatggataaagatggctatatttccaatggg
gaactcttccaggtgctgaagatgatggtggggaacaatctgaaagatacacaattacag
caaattgtagacaaaaccataataaatgcagataaggatggagatgggagaatatccttt
gaagaattctgtgctgttgtaggcggcctagatatccacaaaaagatggtggtagatgtg
tga

DBGET integrated database retrieval system