KEGG   Miniopterus natalensis: 107536128
Entry
107536128         CDS       T05883                                 

Gene name
PDE1A
Definition
(RefSeq) calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A
  KO
K13755  calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase [EC:3.1.4.17]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna01100  Metabolic pathways
mna04020  Calcium signaling pathway
mna04740  Olfactory transduction
mna04742  Taste transduction
mna04924  Renin secretion
mna05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107536128 (PDE1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107536128 (PDE1A)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    107536128 (PDE1A)
  09157 Sensory system
   04740 Olfactory transduction
    107536128 (PDE1A)
   04742 Taste transduction
    107536128 (PDE1A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107536128 (PDE1A)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     107536128 (PDE1A)
SSDB
Motif
Pfam: PDEase_I PDEase_I_N
Other DBs
NCBI-GeneID: 107536128
NCBI-ProteinID: XP_016067277
LinkDB
Position
Unknown
AA seq 514 aa
MDDHVTIKKKHLQRPIFRLRCLVKQLEKGDVNIVDLKKNIEYAASVLEAVYIDETRRLLD
TEDELGDIQSDSVPLEVRDWLASTFTQKMGIMKKKSEEKPKFRSIVHAVQAGIFVERMYR
KSYHMVGLAYPEAVIVTLKEVDKWCFDVFALNEASGEHSLKFMIYELFTRYDLINRFKIP
VSCLIAFAETLEVGYSKYKNPYHNLIHAADVTQTVHCIMLHTGIMHWLTELEILAMVFAA
AIHDYEHTGTTNNFHIQTRSDVAILYNDRSVLENHHVSAAYRLMQEEEMNVLINLSKDDW
RDLRNLVIEMVLSTDMSGHFQQIKNIRNSLQQPEGIDRAKTMSLILHAADISHPAKCWQL
HHRWTMALMEEFFRQGDKEAELGLPFSPLCDRNSTMVAQSQIGFIDFIVEPTFSLLTDSI
EIIIIPLIEEDSKTENSYGASRRSNMKGTVNDGTYFPDYSLASVDLNSFKNNLVDIIQQN
KERWKELAAQGEPDLRKNSEGQGNAGEKCADTHS
NT seq 1545 nt   +upstreamnt  +downstreamnt
atggatgaccatgtcacaatcaagaagaagcatctccaaagacccatctttagactaaga
tgcttggtgaagcagctggagaaaggtgatgtgaacatcgtagacttgaagaagaatatt
gaatatgcagcatctgtgttggaagccgtttatatcgatgaaacaagaagactgctggat
accgaagatgagcttggtgacatccagtcagattcggtcccactggaagtccgggactgg
ctggcttcgacctttacacagaaaatggggatcatgaaaaagaaatctgaggagaagcca
aagtttcggagcattgtgcatgctgttcaagctgggatttttgtggaaaggatgtacaga
aagtcctatcacatggttggtttggcatatccagaagctgtcatagtaacattaaaggaa
gttgataaatggtgttttgatgtatttgccttaaatgaagcaagtggagaacatagcctg
aagtttatgatttatgaactgtttaccagatacgatcttatcaaccgtttcaagattcct
gtttcttgcctaattgcctttgcagaaactttagaagttggttacagcaagtacaaaaat
ccttatcacaatctgatccacgcagcggatgtcactcaaactgtgcattgcataatgctt
catacaggcatcatgcactggctcacggaactggaaattttagcaatggtctttgccgct
gccattcacgactatgagcacacgggaaccacaaacaacttccatattcagacaaggtca
gatgttgccattttgtataacgatcgatccgtccttgaaaatcaccatgtgagtgcagct
tatcgacttatgcaagaagaagaaatgaatgtcttgataaatttatccaaagatgactgg
agggatcttcggaacctagtgattgaaatggttttgtctacagacatgtcaggtcacttc
cagcaaatcaaaaatataagaaacagtttgcagcagcccgaagggatcgacagagccaag
accatgtccctgattctccacgcagcagacatcagccacccggccaaatgctggcagctg
caccaccggtggaccatggccctgatggaggagtttttccgacagggagataaagaagct
gaattagggcttccattttccccgctctgcgatcggaactcaacgatggtggcccagtca
cagataggttttattgatttcatcgtagagccaacattttctcttctgacagactcaata
gagatcattattattcctcttatagaggaagactcaaaaacggaaaattcttacggagca
agcagacgatcgaatatgaaaggcacggtgaacgatggaacctacttcccagactactct
cttgcaagtgtggacctgaacagcttcaaaaacaacctggtggacatcatccagcagaac
aaggagagatggaaagagttagctgctcaaggtgaacctgatcttcgtaagaattcagaa
ggtcaaggaaatgctggagaaaaatgtgctgatacacattcatag

KEGG   Miniopterus natalensis: 107541075
Entry
107541075         CDS       T05883                                 

Gene name
PDE1B
Definition
(RefSeq) calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B isoform X1
  KO
K13755  calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase [EC:3.1.4.17]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna01100  Metabolic pathways
mna04020  Calcium signaling pathway
mna04740  Olfactory transduction
mna04742  Taste transduction
mna04924  Renin secretion
mna05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107541075 (PDE1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107541075 (PDE1B)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    107541075 (PDE1B)
  09157 Sensory system
   04740 Olfactory transduction
    107541075 (PDE1B)
   04742 Taste transduction
    107541075 (PDE1B)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107541075 (PDE1B)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     107541075 (PDE1B)
SSDB
Motif
Pfam: PDEase_I PDEase_I_N La_HTH_kDCL
Other DBs
NCBI-GeneID: 107541075
NCBI-ProteinID: XP_016073498
LinkDB
Position
Unknown
AA seq 535 aa
MELSPRSPPEMLESDCPSPLELKSAPSKKMWIKLRSLLRCMVKQLENGEVNIEELKKNLE
YTASLLEAVYIDETRQILDTEDELQELRSDAVPSEVRDWLASTFTQQTRAKGRRAEEKPK
FRSIVHAVQAGIFVERMFRRTYTSVGPTYSTAVLNCLKNLDLWCFDVFSLNRAADDHALR
TIVFELLTRHNLISRFKIPTVFLMTLLDALETGYGKYKNPYHNQIHAADVTQTVHCFLLR
TGMVHCLSEIEVLAIIFAAAIHDYEHTGTTNSFHIQTKSECAILYNDRSVLENHHISSVF
RMMQDDEMNIFINLTKDEFVELRALVIEMVLATDMSCHFQQVKSMKTALQQLERIDKSKA
LSLLLHAADISHPTKQWSVHSRWTKALMEEFFRQGDKEAELGLPFSPLCDRTSTLVAQSQ
IGFIDFIVEPTFSVLTDVAEKSVQPLVDEDSKSKSQPSFQWRQPSLDVEVGDPNPDVISF
RSTWTKYIQENKQKWKEQAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGNLD
NT seq 1608 nt   +upstreamnt  +downstreamnt
atggagctgtcccctcgcagccctcccgagatgctggagtcggactgcccgtcacccctg
gagctgaagtcagcccccagcaagaagatgtggattaagcttcggtcgctgctacgatgc
atggtgaagcagctggagaatggggaggtcaacattgaggagctgaagaaaaacctggag
tacacagcctccctgctggaggccgtctacatagatgagactcggcaaatcttggacaca
gaggatgagcttcaggagcttcggtcagacgccgtgccttcggaggtgcgggactggctg
gcctccaccttcacccagcagacccgggccaaaggccgccgggcagaggagaagcccaag
ttccgcagcatcgtgcacgccgtgcaggctggcatcttcgtggaacggatgttccggaga
acgtacacctctgtgggtcccacctattccactgctgtcctcaactgtctcaagaacctg
gacctctggtgctttgatgtcttttccttgaaccgggcagcggatgaccacgctctgagg
accattgtttttgagttgctgactcggcataacctcatcagccgctttaagattcccact
gtgtttttgatgactttactggatgctttggagacaggctatgggaagtacaagaaccct
taccacaaccagatccacgcagctgatgttacccagacagtccactgctttttgcttcgc
acagggatggtgcactgcctgtcagagatcgaggtgttggccatcatctttgcagcagcc
atccacgactatgaacacacaggcactaccaacagcttccacatccagaccaagtcagaa
tgtgccatcctgtacaatgaccgctcagtgctggagaatcaccacatcagctctgttttc
cgaatgatgcaggacgacgagatgaacattttcatcaacctcaccaaggatgagtttgta
gagttgcgggccctggtcattgagatggtattggccacagacatgtcctgtcatttccag
caagtgaagtccatgaagacagccttgcagcagctggagaggattgacaagtccaaggcc
ctatctctactgctccatgctgcagacatcagccacccaaccaagcagtggtcagttcac
agccgctggaccaaggctctcatggaagaattcttccgccagggtgacaaggaggcagag
ctgggtctgcccttttccccgctgtgtgaccgtacttccactctcgtggcacagtcccag
attggtttcatcgacttcattgtggagcccacattctctgtgctgactgatgtggctgag
aagagtgtccagcccctggtggatgaagactccaagtctaaaagccagcccagcttccag
tggcgccagccttctctggatgtggaagttggagaccccaaccctgatgtgatcagcttc
cgctccacctggaccaaatacattcaggagaacaagcagaaatggaaggaacaggcagca
agtggcatcaccaaccagatgtccattgacgagctgtccccctgtgaggaggaagcccca
ccctcccctgccgaagatgaacacaaccagaatgggaatctggactag

KEGG   Miniopterus natalensis: 107544407
Entry
107544407         CDS       T05883                                 

Gene name
PDE1C
Definition
(RefSeq) calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1C
  KO
K13755  calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase [EC:3.1.4.17]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna01100  Metabolic pathways
mna04020  Calcium signaling pathway
mna04740  Olfactory transduction
mna04742  Taste transduction
mna04924  Renin secretion
mna05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107544407 (PDE1C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107544407 (PDE1C)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    107544407 (PDE1C)
  09157 Sensory system
   04740 Olfactory transduction
    107544407 (PDE1C)
   04742 Taste transduction
    107544407 (PDE1C)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107544407 (PDE1C)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     107544407 (PDE1C)
SSDB
Motif
Pfam: PDEase_I PDEase_I_N
Other DBs
NCBI-GeneID: 107544407
NCBI-ProteinID: XP_016077780
LinkDB
Position
Unknown
AA seq 647 aa
MESPTKEIEEFESNSLKYLQPEQIEKIWLRLRGLRKYKKTSQRLRSLVKQLERGEASVVD
LKKNLEYAAAVLESVYIDETRRLLDTEDELSDIQSDAVPSEVRDWLASTFTRQMGMMLRR
SEEKPRFKSIVHAVQAGIFVERMYRRTSNMVGLSYPAAVIEALKDVDRWSFDVFSLNEAS
GDHALKFIFYELLTRYDLISRFKIPISALVSFVEALEVGYSKHKNPYHNLVHAADVTQTV
HYLLYKTGVANWLTELEIFAIIFSAAIHDYEHTGTTNNFHIQTRSDPAILYNDRSVLENH
HLSAAYRLLQDDEEMNILVNLSKDDWREFRTLVIDMVMATDMSCHFQQIKAMKTALQQPE
AIEKPKALSLMLHTADISHPAKAWELHHRWTMSLLEEFFRQGDREAELGLPFSPLCDRKS
TMVAQSQVGFIDFIVEPTFTVLTDMTEKIVNPLIDEPSQTAGAGQRRSSLNSLSAADPKR
SGAKSAGSEGSAAISSAVIPVDYKSFKATWTEVVHTNRERWRAKVPKEEKAKKEAEEEAR
LAAEASSQAGGGAAEQATPGEAQNQVNGARPGKGDSSRGKNSKAEKSAGEKQQNGDLKDG
KNKGDKKDPSNVGNDSKKADGTKKRSHGSPAPSASSASRLTLPGDYG
NT seq 1944 nt   +upstreamnt  +downstreamnt
atggagtcaccgaccaaggagattgaagaatttgagagcaactctctgaaatacttgcag
ccagaacaaatcgagaaaatctggctccggctccgagggctgagaaaatataagaaaacg
tcccagaggttacggtctttggtcaaacaattagagagaggggaggcttcggtggtagat
cttaagaagaatctggaatatgcagccgcagtgcttgagtccgtgtacatcgatgaaacc
aggcgactcctggacacggaggacgagctcagcgacatccagtcagacgcggtgccttcc
gaggtccgagactggctggcctccaccttcacgcgccagatggggatgatgctgcggcgg
agcgaggagaagccgaggttcaagagcatcgtgcacgcggtgcaggccgggatattcgtg
gagagaatgtataggcggacatcaaacatggttggactgagctacccagcggcggttatt
gaagcgttaaaggacgtggacaggtggtccttcgatgtcttttccctcaatgaagccagc
ggggaccatgctctgaaattcattttctatgaattactcacacgctacgatctgatcagc
cgtttcaagatccccatttctgcactcgtctcgtttgtggaggccctggaagtgggatac
agcaagcataaaaatccttaccacaatttagtgcacgccgctgatgtcacacagacggtg
cattacctcctctacaagacgggagtcgctaactggctgacggagctggagatttttgct
ataatcttctcagctgccatccacgactacgagcacactgggaccaccaacaacttccac
atccagacccggtccgaccccgctattctgtacaacgacaggtcggtgctggaaaaccac
cacttgagtgcggcctaccgccttcttcaggacgacgaggagatgaacatcctggtcaac
ctttccaaggacgactggagggaatttcggaccttggtgattgacatggtgatggccacg
gatatgtcttgtcatttccaacagatcaaagcgatgaagacagctctgcagcagccggaa
gcgattgagaagcccaaagccttatccctgatgctgcacacggcggacatcagccatccc
gccaaggcgtgggagctccaccaccgctggaccatgtcgctgctggaggaattcttcaga
cagggggacagagaagcggagctggggctgcctttttcgcctctgtgtgacaggaagtcg
accatggttgctcagtcgcaagtaggctttatcgatttcatcgtggagcccaccttcacg
gtgctcacggacatgactgagaagatcgtgaaccccctaatcgacgagccttcccagacg
gcgggggcggggcagcggcgctcgagcctgaacagcctcagtgcggcggacccaaagcga
tcgggtgcgaagagcgctggttcggaagggagcgctgcgatcagcagtgctgtcatccct
gtcgactacaagagctttaaagccacgtggactgaggtcgtgcacaccaatcgggagcga
tggagggccaaggtgcccaaagaggagaaggccaagaaagaggcggaggaggaggcgcgc
ctggcggcggaggccagcagccaggccggtgggggcgcggccgagcaggcgacccccggg
gaggctcagaaccaggtcaacggcgcgcgccccggcaaaggcgacagctctcgtgggaaa
aactccaaagctgagaagtcggcaggagaaaagcagcagaacggtgacttgaaagatggt
aaaaataagggagacaagaaggatccatccaatgtcggaaatgactccaagaaagcagac
ggcacgaagaagcgctcgcacggctccccggcccccagcgccagctccgcgagtcgcctc
acgctgccaggggactacggataa

DBGET integrated database retrieval system