KEGG   Miniopterus natalensis: 107536136
Entry
107536136         CDS       T05883                                 

Gene name
CACNA1B
Definition
(RefSeq) voltage-dependent N-type calcium channel subunit alpha-1B
  KO
K04849  voltage-dependent calcium channel N type alpha-1B
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04020  Calcium signaling pathway
mna04721  Synaptic vesicle cycle
mna04723  Retrograde endocannabinoid signaling
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04930  Type II diabetes mellitus
mna05016  Huntington disease
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05032  Morphine addiction
mna05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107536136 (CACNA1B)
   04020 Calcium signaling pathway
    107536136 (CACNA1B)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107536136 (CACNA1B)
   04725 Cholinergic synapse
    107536136 (CACNA1B)
   04728 Dopaminergic synapse
    107536136 (CACNA1B)
   04726 Serotonergic synapse
    107536136 (CACNA1B)
   04723 Retrograde endocannabinoid signaling
    107536136 (CACNA1B)
   04721 Synaptic vesicle cycle
    107536136 (CACNA1B)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    107536136 (CACNA1B)
   05020 Prion disease
    107536136 (CACNA1B)
   05022 Pathways of neurodegeneration - multiple diseases
    107536136 (CACNA1B)
  09165 Substance dependence
   05032 Morphine addiction
    107536136 (CACNA1B)
   05033 Nicotine addiction
    107536136 (CACNA1B)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107536136 (CACNA1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107536136 (CACNA1B)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107536136 (CACNA1B)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 107536136
NCBI-ProteinID: XP_016067249
LinkDB
Position
Unknown
AA seq 2102 aa
LNPRTPFEYMILATIIANCIVLALEQHLPEGDKTPMSERLDDTEPYFIGIFCFEAGIKII
ALGFVLHKGSYLRNGWNVMDFVVVLTGDPPPPAGLQVVLKSIMKAMVPLLQIGLLLFFAI
LMFAIIGLEFYMGKFHKACFPNGTEGDPVGDFPCGKEAPARLCEGDTECREYWPGPNFGI
TNFDNILFAILTVFQCITMEGWTDILYSTNDAAGNTWNWLYFIPLIIIGSFFMLNLVLGV
LSGEFAKERERVENRRAFLKLRRQQQIERELNGYLEWIFKAEEVMLAEEDKNAEEKSPLD
VLKRAATKKSRNDLIHAEEGEDRFADLCAVGSPFARASLKSGKTEGSSYFRRKEKMFRFF
VRRMVKAQSFYWVVLCVVALNTLCVAMVHYNQPQRLTTALYFAEFVFLGLFLTEMSLKMY
GLGPRSYFRSSFNCFDFGVIVGSIFEVVWAAIKPGTSFGISVLRALRLLRIFKVTKYWNS
LRNLVVSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFKDETPTTNFDTFPAAIL
TVFQILTGEDWNAVMYHGIESQGGVSKGMLSSFYFIVLTLFGNYTLLNVFLAIAVDNLAN
AQELTKDEEEMEEAANQKLALQKAKEVAEVSPMSAANVSITAFVKQTRGTVSRSSSVSSV
NSPRQQNSAKARSVWEQRASQLRLQNLRASCEALYSELDPEERLRYATTRHLRPDMKTHL
DRPLVVEPGRDGARGPSAEEPVRRHRARHRAPPAHEDAEKEAKEAAAKEGEGEDRDKEKE
PRNPQPQEPHCDLEASGIMGVGPVHALPSTCVQKVEEQPEDADNQRNVTRMGSQPSDPSA
TAHIPVTQTGPPGETTVVPSGSVDLDGQAEGKKEVEANDEMRSGPRPIVPYSSMFCLSPT
NLLRRFCHYIVTMRYFEMVILIVIALSSIALAAEDPVHTDSPRNNVLKYMDYIFTGVFTF
EMVIKMIDLGLLLHPGAYFRDLWNILDFIVVSGALVAFAFSGSKGKDINTIKSLRVLRVL
RPLKTIKRLPKLKAVFDCVVNSLKNVLNILIVYMLFMFIFAVIAVQLFKGKFFYCTDESK
ELERDCRGQYLDYEREEVEAQPRQWKKYDFHYDNVLWALLTLFTVSTGEGWPMVLKHSVD
ATYEEQGPSPGFRMELSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKVMSECSLEKNE
RACIDFAISAKPLTRYMPQNKQSFQYRTWTFVVSPPFEYFIMAMIALNTVVLMMKFYDAP
YEYELMLKCLNIVFTSMFSMECVLKIIAFGVLNYFRDAWNIFDFVTVLGSITDILVTEIA
NNFINLSFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGM
QVFGNIALDDDSSINRHNNFRTFLQALMLLFRSATGEAWHEIMLSCLSNQACDEQANASE
CGSDFAYFYFVSFIFLCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFIRVWAEYDP
AACGRITYSDMFEMLKHMSPPLGLGKKCPARVAYKRLVRMNMPISNEDMTVHFTSTLMAL
IRTALEIKLAPAGTKQHQCDAELRKEISCVWANLPQKTLDLLVPPHKPDEMTVGKVYAAL
MIFDFYKQSKTSRDQTHQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLQQKSSA
SLSNGGAVQTQESGIKESVSWGTQRTQEVPYEARAPLERGHSTEIPVVQPGKPAVDVQMQ
SMALRGPDGEPQSGLESQGRAASMPRLAAETQAASEASPMKRSVSTLAPQRPHVAHLCNA
ALDRAPASQAAPHHHHRCHRRRDRKQKSLEKGPSLSADADGAPSSTAGPGPPPGEGPTGG
RRERRQERQERGRSQERRQPSSSSSEKQRFYSCDRFGGREPLQPRPSLCSHPTSPTAGQE
PGPPRQGSGSVNGSPLLSTSGASTPGRGGRRQLPQTPLTPRPSVTYKTANSSPVHFAGAQ
SSLPTFSPGRLSRGLSEHNALLQRDPLSQPLAPSSRIGSDPYLGQRLDSDAAVRTQPEDM
LTFEEAVATNSGRSSRTSYVSSLTSQSHPLRRVPNGYHCTLGLGSGGRARHSYHHPDQDH
WC
NT seq 6309 nt   +upstreamnt  +downstreamnt
cttaacccgcgcactccgttcgagtacatgatcctggccaccatcatcgccaactgcatc
gtgctggccctggagcagcacctccctgagggcgacaagacgcccatgtccgagcgcctg
gacgacaccgagccctatttcatcggcatcttctgcttcgaggcggggatcaagatcatt
gcgctgggcttcgtgctgcacaaggggtcctacctgcgcaacggctggaacgtcatggac
ttcgtggtggtcctcaccggtgacccgcccccgcccgcaggcctgcaggtggtgctcaag
tccatcatgaaggccatggtgccgctgctgcagatcgggctgctgctcttcttcgccatc
ctcatgttcgccatcattggcctcgagttctacatgggcaagttccataaggcctgtttc
cccaatggcacagaaggagacccagtgggcgacttcccctgtggcaaagaggcgcctgcc
cggctgtgtgagggagacaccgagtgccgggagtactggccaggacccaactttggcatc
accaacttcgacaacatcctgttcgccatcctgacagtattccagtgcatcaccatggag
ggctggacagacatcctctacagcacaaatgatgctgctggcaacacctggaactggctg
tatttcatccctctcatcatcatcggctccttcttcatgctcaacctggtactgggcgtg
ctctcgggagagttcgccaaggagcgtgagcgggtggagaaccgccgggccttcctgaag
ctgcggcggcagcagcagatcgaaagggagctcaacgggtacctggagtggatcttcaag
gccgaggaagtcatgctggctgaggaggacaagaatgccgaggagaagtcccccctggat
gtgttgaagagggcagccaccaagaagagccgaaatgacctgatccatgctgaggaggga
gaggaccggtttgcagacctctgtgccgtggggtcccccttcgcccgtgccagcctcaag
agtgggaagacggagggctcgtcctacttccgcaggaaggagaagatgttccggttcttt
gtgcggcgcatggtgaaggcacagagcttctactgggtggtgctgtgcgtggtggccctg
aacacgctgtgtgtggccatggtgcactacaaccagccccagcggctcaccacagcgctg
tactttgcagagtttgttttcctgggtctcttcctcacagagatgtccctgaagatgtat
ggcttggggcccaggagttacttccggtcctccttcaactgctttgactttggggtcatt
gtggggagcatcttcgaagtggtctgggctgccatcaagccaggaacctcctttgggatc
agcgtgctgcgggcactccggctgctgaggatcttcaaagtcacgaagtactggaactct
ttgcggaacctggtggtgtcactgctcaactccatgaagtcgatcatcagcctcctgttc
ctgctcttcctgttcattgtggtcttcgccctgctgggcatgcagctgtttgggggacag
ttcaactttaaagatgagactccaacaaccaactttgacaccttccctgccgccatcctc
actgtcttccagatcctgaccggagaggactggaacgcagtgatgtaccacgggatcgag
tcgcagggtggcgtcagcaagggcatgctgtcgtccttctacttcatcgtcctgacgctg
tttggaaactacaccttactgaacgtattcctggccattgctgtggacaatcttgccaat
gcccaggagctgaccaaggatgaagaggagatggaagaagcagccaatcagaagcttgct
ctgcagaaggccaaggaagtggctgaagtcagccccatgtcagccgcgaacgtctccatc
actgcttttgtaaagcaaactcgaggtactgtatctcgcagctcgtctgtctccagcgta
aactcacccaggcagcagaactcagccaaggcgcgctccgtgtgggagcagcgggcgagc
cagctgcggctgcagaacctgcgggccagctgcgaggcgctgtacagcgagctggacccc
gaggagcggctgcgctacgccaccacgcgccacctgcggcccgacatgaagacgcacctg
gaccggccgctggtggtggagcccggccgcgatggcgcgcggggcccgagcgcggaggag
ccagtgcggaggcaccgggcccggcacagggcgccgcccgcgcacgaggatgccgagaag
gaggccaaggaggcggcagcgaaggagggcgagggcgaggaccgggacaaggagaaggag
ccgcggaacccccagccccaggagccacactgtgacctggaggccagtgggataatgggc
gtgggtccagtgcatgcactgcccagcacctgtgtacagaaggtggaagaacagccagag
gatgcagataatcagcggaacgtcactcgaatgggcagtcaaccctcagacccaagtgcc
actgctcatatcccagtgacacagactggccctcctggggagaccacagttgttcccagc
ggcagcgtggacctggacggccaggcggaggggaagaaggaggtggaagccaatgacgag
atgaggagtggcccccgccccatcgtcccatacagctccatgttctgtctgagccccacc
aacctgctccgccgcttctgccattacatagtgaccatgcggtacttcgagatggtcatc
ctcatagtcattgccctgagcagcatcgccctggccgcagaggaccctgtgcacacagac
tcccccaggaacaatgttctgaagtacatggactacatcttcacaggtgtcttcaccttt
gagatggtgataaagatgattgatttgggactgctgctgcacccaggggcctacttccga
gacctgtggaacattctggacttcattgtggtcagtggggccctggtggcgtttgccttc
tcaggatccaaagggaaggacatcaataccatcaagtccctgagagtcctgcgcgtcctg
cgacccctgaagaccatcaagcggctgccgaagctcaaggccgtgttcgactgtgtggtg
aactcactgaagaacgttctcaacatcctcatcgtctacatgcttttcatgttcatcttc
gccgtcatcgccgtgcagctgttcaaggggaagttcttctactgcaccgacgagtccaag
gagctggagcgggactgcaggggccagtacttggattacgagcgggaggaggtggaagct
caaccacggcagtggaagaagtacgacttccactatgacaacgtgctctgggcactgctc
acgctgttcacggtgtccacgggagaagggtggcccatggtgctgaagcactccgtggac
gccacctacgaggagcagggcccgagccctgggttccgcatggagctgtccatcttctac
gtggtctacttcgtggtcttccccttcttcttcgtcaacatcttcgtggccttaatcatc
atcacgttccaggagcagggcgacaaagtgatgtctgagtgcagcctggagaagaatgag
agagcctgcattgacttcgccatcagcgccaagcccctgacgcggtacatgccacagaac
aagcagtccttccagtacaggacgtggaccttcgtggtctcgccacccttcgagtacttc
atcatggccatgatcgctctcaacaccgtggtgctgatgatgaagttctatgatgcgccc
tacgagtacgagctgatgctgaagtgcctgaacatcgtgttcacgtccatgttctccatg
gagtgcgtgctcaagatcatcgcctttggggtgctgaactacttcagagatgcctggaac
atcttcgactttgtcactgtgttgggaagtattactgatattttagtaacagagattgcg
aacaacttcatcaacctcagcttcctgcgccttttccgcgccgcccggctcatcaagctg
ctgcgccagggctacaccatccgcatcctgctctggacgttcgtgcagtccttcaaggcc
ctgccctacgtgtgcctgctgatcgccatgctgttcttcatctatgccatcatcggcatg
caggtgtttggaaacattgccctggatgatgactccagcatcaacaggcacaacaacttc
cggacgtttctacaagccctgatgctgctgttcaggagtgccaccggggaggcctggcat
gagatcatgctgtcctgtctcagcaaccaggcctgtgatgagcaagccaatgccagtgag
tgcggcagcgactttgcctacttctacttcgtctccttcatcttcctgtgctcctttctg
atgttgaacctgtttgtggctgtgatcatggacaattttgagtacctcacgcgggactct
tccatcctagggcctcaccacctggacgagttcatcagggtctgggctgagtacgacccc
gctgcgtgtgggcgcatcacttacagtgacatgtttgagatgctgaaacacatgtccccg
cccctggggctggggaagaaatgccctgctcgagtggcgtacaagcgcctggttcgcatg
aacatgcccatctccaatgaggatatgaccgtccatttcacgtccacactgatggccctc
atccggactgcactggagatcaagctggctccagccggcacgaagcagcaccagtgtgat
gcagaactgaggaaggagatttcctgtgtgtgggccaatcttccccagaagactctggac
ttgttggtgccgccccacaaacctgacgagatgacggtggggaaggtctacgcagctctg
atgatcttcgacttctacaaacagagcaagaccagcagagaccagacccaccaagctcct
ggaggcctgtcccagatgggcccggtgtccctgtttcaccctctgaaggctacactggag
cagacgcagccggctgtgctccgaggagcccgggtttttcttcagcagaagagctcagcc
tccctgagcaatggcggggccgtgcaaacccaagagagtggcatcaaggagtctgtttcc
tggggcactcagaggacgcaagaagtgccctatgaggcaagggcccccttggagcgaggc
cactcgacagaaatcccagtggtgcagccaggaaaaccagctgtggatgtccagatgcag
agcatggccctgaggggccctgacggggagccccagtccgggctggagagccagggccga
gcggcctccatgccccgcctggcagcagagacccaggcggcctcagaggccagccccatg
aagcgctcagtctccacgctggcgccccagcgcccccatgtggctcatctctgcaatgcc
gccctggaccgggctccagccagccaggccgccccccaccaccaccaccgctgccaccgc
cgccgggacaggaaacagaagtccctggagaaggggcccagcctatccgcagatgcagat
ggtgcccccagcagcactgcagggccagggccgcccccaggagaggggcccacaggcggc
cggcgggagcgcaggcaggagaggcaggagcggggtcggtcccaggagcgcaggcagccc
tcctcctcctcctctgagaagcagcgcttctactcgtgtgaccgctttgggggccgggag
cccctgcagcccaggccctccctctgcagccatcccacatcgccaaccgctgggcaggag
ccaggacccccgagacagggcagcggttccgtaaacgggagccccctactgtccacatct
ggtgctagcacccctggccgcggtgggcggaggcagcttccccagactccactgacgccc
cggcccagtgtcacctacaagacagccaactcctcgcccgtgcacttcgccggggcccag
agcagtctccccaccttctccccgggccggctgagccgaggcctttcagaacacaatgcc
ctgctccagagggaccccctcagtcagccgctcgcccccagctctcggattggctctgac
ccttacctggggcagcgtctggacagtgacgccgcagtgcgcacccaaccagaggacatg
ctcacctttgaggaggccgtggccaccaactcgggccgctcctcccggacttcctacgtg
tcctccctgacctcccagtcccacccactgcgccgggtgcccaatggctaccactgcact
ctggggctcggctcaggcggccgcgctcggcacagctaccaccacccggaccaagaccac
tggtgctag

KEGG   Miniopterus natalensis: 107541038
Entry
107541038         CDS       T05883                                 

Gene name
CACNA1A
Definition
(RefSeq) voltage-dependent P/Q-type calcium channel subunit alpha-1A
  KO
K04344  voltage-dependent calcium channel P/Q type alpha-1A
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04020  Calcium signaling pathway
mna04721  Synaptic vesicle cycle
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04730  Long-term depression
mna04742  Taste transduction
mna04930  Type II diabetes mellitus
mna05017  Spinocerebellar ataxia
mna05032  Morphine addiction
mna05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107541038 (CACNA1A)
   04020 Calcium signaling pathway
    107541038 (CACNA1A)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    107541038 (CACNA1A)
   04727 GABAergic synapse
    107541038 (CACNA1A)
   04725 Cholinergic synapse
    107541038 (CACNA1A)
   04728 Dopaminergic synapse
    107541038 (CACNA1A)
   04726 Serotonergic synapse
    107541038 (CACNA1A)
   04730 Long-term depression
    107541038 (CACNA1A)
   04723 Retrograde endocannabinoid signaling
    107541038 (CACNA1A)
   04721 Synaptic vesicle cycle
    107541038 (CACNA1A)
  09157 Sensory system
   04742 Taste transduction
    107541038 (CACNA1A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    107541038 (CACNA1A)
  09165 Substance dependence
   05032 Morphine addiction
    107541038 (CACNA1A)
   05033 Nicotine addiction
    107541038 (CACNA1A)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107541038 (CACNA1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107541038 (CACNA1A)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107541038 (CACNA1A)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel DUF2207
Other DBs
NCBI-GeneID: 107541038
NCBI-ProteinID: XP_016073449
LinkDB
Position
Unknown
AA seq 2199 aa
MYKQSMAQRARTMALYNPIPVRQNCLTVNRSLFLFSEDNVVRKYAKKITEWPPFEYMILA
TIIANCIVLALEQHLPDDDKTPMSERLDDTEPYFIGIFCFEAGIKIIALGFAFHKGSYLR
NGWNVMDFVVVLTGILATVGTEFDLRTLRAVRVLRPLKLVSGIPSLQVVLKSIMKAMIPL
LQIGLLLFFAILIFAIIGLEFYMGKFHTTCFEEGTDDIQGESPAPCGTEEPARTCPNGTK
CQPYWEGPNNGITQFDNILFAVLTVFQCITMEGWTDLLYNSNDASGNTWNWLYFIPLIII
GSFFMLNLVLGVLSGEFAKERERVENRRAFLKLRRQQQIERELNGYMEWISKAEEVILAE
DETDGEQRHPFDALRRATIKKSKTDLLNPEEAEDQLADIASVGSPFARASIKSAKLENST
FFHKKERRVRFYIRRMVKTQAFYWTVLSLVALNTLCVAIVHYNQPEWLSDFLYYAEFIFL
GLFMSEMFIKMYGLGTRPYFHSSFNCFDCGVIIGSIFEVIWAVIKPGTSFGISVLRALRL
LRIFKVTKYWASLRNLVVSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFDEGTP
PTNFDTFPAAIMTVFQILTGEDWNEVMYDGIKSQGGVQGGMVFSIYFIVLTLFGNYTLLN
VFLAIAVDNLANAQELTKDEQEEEEAANQKLALQKAKEVAEVSPLSAANLSIAVKEQQKN
QKPTKSVWEQRTSEMRKQNLLASREALYNEMDPDERWKATYARHLRPDMKTHLDRPLVVD
PQENRNNNTNKSRAAEPTVDQRLGQQRAEDFLRKQARFHDRGGERRRRHRHGAAATYDPD
ARREDKERRHRRRKKQPSWQEKQQLKSGEVGSDITWGSRTSVPGTLAGFGTRLSMSEVDT
QGSGVPVSGPNLSTTRPIQQDLGRQDPPLAEDIDNMKNNKLATAESASPHDSLGHPGLSQ
SPAKMGNSTNPGPTTAPSATATNPQNTTSRRMPNNPGNPSNPGPPKTPENSLIVTNPSTT
QTNSAKTARKPDHTAVDIPPACPPPLNHTVVQVNKNANPDPLPKKEEEKKEEEEDDPGED
GPKPMPPYSSMFILSTTNPLRRLCHYILNLRYFEMCILMVIAMSSIALAAEDPVQPNAPR
NNVLRYFDYVFTGVFTFEMVIKMIDLGLVLHQGAYFRDLWNILDFIVVSGALVAFAFTGN
SKGKDINTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVNSLKNVFNILIVYMLFMFIFAV
VAVQLFKGKFFHCTDESKEFEKDCRGKYLLYEKNEVKARDREWKKYEFHYDNVLWALLTL
FTVSTGEGWPQVLKHSVDATFENQGPSPGYRMEMSIFYVVYFVVFPFFFVNIFVALIIIT
FQEQGDKMMEEYSLEKNERACIDFAISAKPLTRHMPQNKQSFQYRMWQFVVSPPFEYTIM
AMIALNTIVLMMKFYGASLAYENALRVFNIVFTSLFSLECLLKVMAFGILNYFRDAWNIF
DFVTVLGSITDILVTEFGNNFINLSFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALP
YVCLLIAMLFFIYAIIGMQVFGNIGIDVEDEDSEEDDFQITEHNNFRTFFQALMLLFRSA
TGEAWHNIMLSCLSGKPCDKNSGILTPECGNEFAYFYFVSFIFLCSFLMLNLFVAVIMDN
FEYLTRDSSILGPHHLDEYVRVWAEYDPAAWGRMPYPDMYQMLRHMSPPLGLGKKCPARV
AYKRLLRMDLPVADDNTVHFNSTLMALIRTALDIKIAKGGADKQQMDAELRKEMMAIWPN
LSQKTLDLLVTPHKSTDLTVGKIYAAMMIMEYYRQSKAKKLQAMREEQNRTPLMFQRMEP
PSPTQEGGPGQNALPSTQLDPGGSLMAHESGIKESPSWVTQRAQEMFQKTGTWSPERGPP
TDMPNSQPNSQSVEMREMGRDGYSDSERYLPTEGQARAASMPRLPAENQRRRGRPRGNNL
STISDTSPMKRSASVLGPKARRLDDYSLERVPPEENQRHHQRRRDRGHRASERSLGRYTD
VDTGLGTDLSMTTQSGDLPSKERDQERGRPKDRKHRQHHHHHHHHHPQPPDKERYTQERP
DHRARARDQRWSRSPSEGPEHMTHRQVGVAGVAPRPSHGGPGKEGGPYTPQLLWAGSSLP
TVTSDPAYHWASSQAKGGLDTGVLAGYTKPYYYCLQKPI
NT seq 6600 nt   +upstreamnt  +downstreamnt
atgtacaagcagtcaatggcgcagagagcgcggaccatggccctctacaaccccatcccc
gtccgacagaactgcctcacggtcaaccggtctctgttcctcttcagcgaggacaacgtg
gtgagaaaatacgccaaaaagatcaccgaatggcctccctttgaatatatgattttagcc
accatcatagcaaactgcatcgtccttgccctggagcaacacctacctgacgatgacaag
acccccatgtctgaacgactggatgacacagaaccgtacttcattggaattttttgtttc
gaggctggcattaaaatcattgcccttgggtttgccttccacaaaggctcttacctgagg
aatggttggaacgtgatggacttcgtggtggtgctaacaggcatcttggcgacagttggg
acagagtttgacctacggacgctgagggcagttcgagtgctgcgaccgctcaagctggtg
tctggaatcccaagtttacaagtcgtcctgaagtcgatcatgaaggcgatgatccccttg
ctgcagattggccttctcctattttttgcaatccttatttttgcaatcatagggttagaa
ttttatatgggaaaatttcataccacctgctttgaagaggggacagatgacattcagggt
gaatctccggctccatgtgggacagaggaacccgcccgcacctgccccaatgggaccaaa
tgccagccctactgggaagggcccaacaatgggatcactcagttcgacaacatcctgttt
gcagtgctgactgttttccagtgcatcaccatggaagggtggactgacctcctctacaac
agcaacgatgcctcagggaacacttggaactggttgtacttcatccccctcatcatcatc
ggctccttttttatgctgaacctcgtgctgggtgtgctgtcaggggagtttgccaaagag
agggagcgggtggagaaccggcgggcttttctgaagctgaggaggcagcaacagattgaa
cgagagctcaatgggtacatggagtggatctcgaaagcagaagaggtgatcctcgccgag
gatgaaactgacggggagcagaggcatccctttgatgctctgcggagagccaccataaag
aagagcaagacagacctgctcaaccccgaggaggctgaggatcagctagccgacattgcc
tctgtggggtctccctttgcccgagccagcattaaaagtgccaagttggagaactcgact
ttttttcacaaaaaggagaggagggtgcgtttctacatccgccgcatggtcaaaactcag
gccttctactggactgtgctcagtctggtagccctcaacacgctgtgtgttgctatcgtt
cactacaaccagcccgagtggctctccgacttcctctactatgcagaattcattttctta
ggactctttatgtccgaaatgtttataaaaatgtacgggcttgggacacggccttatttc
cactcttccttcaactgctttgactgtggggttatcatcgggagcatctttgaggtcatc
tgggccgtcataaaacccggcacatcctttggaatcagtgtgttacgagccctcaggtta
ttgcgtattttcaaagtcacaaagtactgggcgtctctcaggaatctggtcgtctctctt
ctcaactccatgaaatccatcatcagcctgttgttcctccttttcctgttcatcgtcgtc
tttgcacttttaggaatgcagctctttggcggccagtttaatttcgatgaagggactcct
cctaccaactttgacacttttccagcagcaataatgacagtgtttcagatcctgacgggc
gaggactggaacgaggtcatgtacgacggcatcaaatctcagggcggcgtgcagggcggc
atggtgttctccatctacttcatcgtgttgacactcttcgggaactacaccctcctgaac
gtgttcttggccatcgcggtggataatttggccaacgcccaggagcttaccaaggatgaa
caagaagaagaagaggcagccaaccagaaactcgccctccagaaagccaaggaggtggca
gaagtgagtcctctgtccgcggccaacttgtccatagctgtgaaggagcaacagaagaac
cagaagccaaccaagtccgtgtgggagcagcggaccagcgagatgcgcaaacagaacctg
ctggccagccgggaggccctgtacaacgagatggaccccgacgagcgctggaaagccacc
tatgcgcggcacctgcggcccgacatgaagacccacctggaccggccgctggtggtggat
ccccaggagaaccgcaacaataacaccaacaagagccgcgcggccgagcccacggtagac
cagcgcctgggccagcagcgggccgaggacttcctccgcaagcaggcgcgcttccacgac
cggggcggcgagcggaggcggcggcaccggcacggcgccgcggccacctacgacccggac
gcgcggagggaggacaaggagcgcaggcaccggcggaggaagaaacagccatcctggcag
gagaagcagcagctgaaatctggggaggtgggcagtgacattacatggggatcaagaacc
tcagtgcccggcacactggccggcttcgggacacgcctctcaatgtccgaggtagacacc
cagggctccggggtacccgtgtcgggccccaacctgtcgaccacccggccgatccagcaa
gacctaggtcgccaagacccgccgctggccgaggacatcgacaacatgaagaacaacaag
ctggccactgcagaatcggccagtccccacgacagcctcggccaccccggcctgtcccag
agcccagccaagatggggaacagcaccaaccccggccccacaacggccccatctgccacg
gccaccaatccccagaataccaccagtcgccggatgcccaacaacccggggaacccctcc
aaccccggcccccccaagactcccgagaacagccttatcgtcaccaaccccagcaccacc
cagaccaactcagctaagactgccaggaaacccgaccacaccgcggtggacatcccccca
gcctgcccgccacccctcaaccacaccgttgtccaagtgaacaaaaacgccaacccagac
ccactgccaaaaaaagaggaagagaagaaggaggaggaggaagacgaccccggggaagac
ggccccaagcccatgcccccctacagttccatgtttatcctttccacgaccaaccccctt
cgccgcctgtgccattacattctgaacctgcgctactttgagatgtgcatcctaatggtc
atcgccatgagcagtattgccctggcggctgaggaccccgtgcagcccaacgcaccacgg
aacaatgtgctacgatattttgactacgttttcacaggcgtctttacctttgagatggtg
atcaagatgattgacctggggctcgtcctgcaccagggtgcctacttccgtgacctctgg
aacattcttgacttcatagtggtcagtggggccctggtggcctttgccttcactggcaat
agcaaaggaaaggacattaacacaatcaaatctctccgagtcctccgggtgctacgacct
cttaaaaccatcaagcggttgccaaagctcaaggccgtgtttgactgtgtggtgaattcc
ctcaagaatgtcttcaacatcctcattgtctacatgctgttcatgttcatctttgccgtg
gtggccgtgcagctcttcaaggggaagttcttccactgcaccgatgagtccaaggagttt
gagaaagactgtcgcggcaagtacctcctgtacgagaagaacgaggtgaaggcgcgggac
cgcgagtggaagaagtatgagttccactacgacaacgtgctgtgggccctgctgacgctc
ttcaccgtgtccacgggcgaaggctggccgcaggttctcaagcactccgtggatgccacc
ttcgagaaccagggtcccagccccgggtaccgcatggagatgtccatcttctatgtcgtc
tactttgtcgtgttccccttcttcttcgtcaatatctttgtggccttgatcatcatcacc
ttccaggagcaaggcgacaagatgatggaggaatacagcctggagaaaaatgagagggcc
tgcatcgacttcgccatcagcgccaaacctctgacccgacacatgccccagaacaagcag
agcttccagtaccgcatgtggcagtttgtggtgtctccgccttttgagtacaccatcatg
gccatgatcgccctcaacaccatcgtgctcatgatgaagttctatggggcctcgcttgct
tatgaaaacgctctgagggtgttcaacatcgtcttcacctccctcttctctctggaatgt
ctgctgaaagtcatggcttttgggattctgaattatttccgcgatgcctggaacatcttc
gactttgtgactgttctgggcagcatcaccgacatcctcgtcactgagtttgggaataac
ttcatcaacctgagcttcctccgcctcttccgagcagcccggctcatcaaactcctccgt
cagggttacaccatccgaattcttctctggacctttgtgcagtcgttcaaggcgctgccc
tacgtctgtctgctgattgccatgcttttcttcatctatgccatcatagggatgcaggtg
tttggcaacattggcattgacgtggaggacgaggacagtgaggaggacgacttccagatc
accgagcacaataacttccgcaccttcttccaggccctgatgctcctcttccggagtgcc
accggggaggcttggcacaacatcatgctttcctgcctcagtgggaaaccctgtgataaa
aactctggcatcctgactcccgagtgtggcaatgagtttgcttatttttacttcgtttcc
ttcatcttcctctgctcgtttctgatgctgaacctctttgtcgctgtcatcatggacaac
tttgagtacctcactcgagattcctccatcctgggtcctcaccacctggatgagtacgtg
cgtgtctgggctgagtacgaccctgcagcatggggccgcatgccttacccggacatgtat
cagatgctgagacacatgtctccgcccctgggtctggggaagaagtgtccggccagagtg
gcttacaagaggctcctgagaatggatctgcctgttgccgatgacaacactgtccacttc
aattctaccctcatggctctgatccgcacagccctggacatcaagattgccaagggaggg
gccgacaaacagcagatggacgccgagctccggaaagagatgatggccatctggcccaac
ctgtcccagaaaacactggacctgctggttacccctcataagtccaccgacctcacagtg
gggaagatctacgcagccatgatgatcatggagtactaccggcagagcaaagccaagaag
ctgcaggccatgcgtgaggagcagaaccggacacctctcatgttccagcgcatggagccc
ccgtcaccaacacaggagggggggcccggccagaatgccctcccctccacccagctggac
ccaggaggaagcctgatggctcacgaaagtggcatcaaggagagtccttcctgggtgacc
cagcgagcccaggagatgttccagaagacgggcacatggagcccggagcggggaccccct
accgacatgcccaacagccagcccaactctcagtctgtggaaatgcgagagatgggccga
gatggctactcagacagtgagcgctacctccccacggaaggccaggctcgggctgcctcc
atgccccgcctccctgcagaaaaccagaggagaaggggccggccacgtgggaataacctc
agtaccatctcagataccagccccatgaagcgctcagcctccgtgctgggccccaaggct
cggcgcctggatgactactctctagagagggtgcctcctgaagaaaaccagcggcaccac
cagcggcgccgagaccgtggccaccgagcctcggagcgctccttgggccgctacacggat
gtggacacaggcttggggacagatctgagtatgaccacccagtctggagacctgccatca
aaggagagggaccaggagcgtggcaggcccaaggaccggaagcaccggcagcaccatcac
caccaccaccaccaccacccccaacccccggacaaggaacgatatacccaggaacggcct
gaccaccgggcccgggccagggaccagcgctggtcccgttcacctagtgagggccccgag
cacatgacacaccggcaggtgggtgtggcaggagttgcccccagacccagccatggggga
ccaggaaaggagggtggcccctacaccccacagctactctgggcaggttcctcactcccc
accgtgacctctgaccctgcctaccattgggcttcttcccaagccaagggcggcctggac
acaggagtgcttgctggttataccaaaccctattattactgcctgcagaaaccgatttaa

DBGET integrated database retrieval system